PRGDB00065565 (Afp.102)

From PRG Wiki
Jump to: navigation, search
Afp.102
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71702019 (DR932656)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1124195 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1OI74, mRNA sequence

DNA Sequence

GAGTCTCAGAGTGAGAGATATCAAAAGATTACAGATATCAACATTACCACCAGGGCACAACAAGAATATAATCTTCAATCTTCCAAATCAAATAATGATGCTACACTATTACAAACAGAAACATCTGCCATGAtttttttttcttttcttttctttGTTACGAACCCAAACTTAAAAATGAAAAACCTTTAGTTTCCACATAAACCCTTCCTACCCCAATACTTTAGACAAATGAGTTGTCACTGTATCCTGTGTAGTTTTCTCTTGGTGTCCATCCCGAATATGAAGAACTCATTGGTGTGGTATCTTGAGTGTTGTTGCTTGTATTACTATCATCTCCAGGTCCCATCATTGGCCAAACAAAAGCTGGTTTGAATGGAGGGACACGAGGTGGTGGAACAGCTCCAGATAGTATCTGAATGATTGTTTGTGTCTTAGGCCTTTCAGATGCTATGGGATGTGAACATGCTAACCCAAGCAATAGAAGCCTCTCTGCTTCTTCCTCCACGAAATCCTTTTCCAGCTTCTCATCGACTGCCTCCAAGATCCGGCCTTCACGATGCAATGTCCAAACCCAATCAGCTAAAAACTGAAACCCAGCAATCTTTGTCCACGGCCGTTGACCGCACACTACTTCCAGTACAACTGCACCAAAGCCAAACACATCCGACTCACGCGTGGCCCTGCCCATGTGGAAACACTCGGGTGCAATGTATCCAGGGGTACCAGGGACCCCTTGTTCCAATTCTGCATAAGAGGTCTTCTCATTGTCTATGGCTCGTGCAAGACCAAAGTCACCCAGCCGTGCATTGTAGTCAGAATCCAGCATCACGTTGCTGGCTTTAAGGTCTCGATGGACAACCTTCTGATCATACTCATTGTGGAGGTAGTGTAGAGCGGATGCAACCCCTGATATAATCTTGTATCTTCGGTCCCAGCCCAATCGTGTCTTTTCTTCATTGTTGTTGAAA


Protein sequences

Name Description Sequence
Afp.102 translated coding region predicted by ESTScan from UniGene Afp.102

XFNNNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQILSGAVPPPRVPPFKPAFVWPMMGPGDDSNTSNNTQDTTPMSSSYSGWTPRENYTGYSDNSFV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-197 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XFNNNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQILSGAVPPPRV

HMMPanther: PTHR24420:SF662
2-222 SUBFAMILY NOT NAMED

FNNNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQILSGAVPPPRVPPFKPAFVWPMMGPGDDSNTSNNTQ

HMMPanther: PTHR24420
2-222 FAMILY NOT NAMED,FAMILY NOT NAMED

FNNNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQILSGAVPPPRVPPFKPAFVWPMMGPGDDSNTSNNTQ

HMMSmart: SM00219
IPR020635
2-188 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNNNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQIL

HMMSmart: SM00220
IPR002290
2-175 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNNNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIA

Gene3D: G3DSA:1.10.510.10
4-186 no description

NNEEKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQ

HMMPfam: PF00069
IPR017442
7-124 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKTRLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKI

superfamily: SSF56112
IPR011009
10-188 Protein kinase-like (PK-like)
Protein kinase-like domain

RLGWDRRYKIISGVASALHYLHNEYDQKVVHRDLKASNVMLDSDYNARLGDFGLARAIDNEKTSYAELEQGVPGTPGYIAPECFHMGRATRESDVFGFGAVVLEVVCGQRPWTKIAGFQFLADWVWTLHREGRILEAVDEKLEKDFVEEEAERLLLLGLACSHPIASERPKTQTIIQIL

PatternScan: PS00108
IPR008271
38-50 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKASNVML

Seg: seg
157-169 seg

EEEAERLLLLGLA

Seg: seg
191-205 seg

AVPPPRVPPFKPAFV

Seg: seg
213-225 seg

DDSNTSNNTQDTT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox