PRGDB00065566 (Afp.116)

From PRG Wiki
Jump to: navigation, search
Afp.116
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74542136 (DT747301)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1181150 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1W757, mRNA sequence

DNA Sequence

GTCATTGGAAAGGTTAAGGATCAGTAAAAACCACTTATCTGGAAGCATTCCGAGCCGGGTGTGGGGACTTCCTTTGGTTCAGATGATCGATTTGGGTGATAATGGTTTTAGTGGAGGAATATCCTCTGAGATAAGGATGTCCACCAGCTTGACTCAATTGTTATTGCAGAACAACAAGTTTGAAGGTCCTCTACCATCTGAACTTGGTGAGCTCACCCTGCTAGAGAAGCTTTCTGCATACAACAATTTGTTTACTGGCAAAGTGCCTGCCGAAATAAAAAAATTGAAGAACTTGTCTTCTTTGCATTTGGAAGAAAACTCATTAACAGGATCGATACCATCAGAAGTTGGGGAATGTATTAGACTGGCGGATTTGAATCTTGCTAAGAACGAACTTAGTGGTGATATTCCGAAAACATTATCATCGTTGAGCAATTTGAACTCTTTAAACTTGTCGCAAAACAGGCTTTCTGGTTCCATTCCCTGGAATTTACAGAGGTTGAAGTTAAGTTCTATTGATTTATCTGGGAACAAGTTAATGGGAAGGATTCCTTTCGATTTGGCAATGACGGGCGGAGATCAGGCATTCTTTGGAAATGCAGGACTTTGCATTGATAATGATCTTGGGGATCATGTAAAATCGAGAATAAGTGTCTGCAAGAGAAGTCAAAATCATAAAAGCACTCTCAAACATAAATTGCTGTTGGGTGGTGTTATATCCTTGGGCCTTGGTTGCTATTATAGCTGGGCTATTGCTTTTGAGTTACAAGAACTTCAAGCTCAATGAATCCCGCGAGGAAAGTGATCTAGAAGGGAAGCTGGAGAAAGATCCATGTTGGAAACTCGAAGCCTTCCATCCGATGGAACTTGATGAAGATGAAATATGTGATTTGAAAGACGACAATCTGATTGGGAGTGGA


Protein sequences

Name Description Sequence
Afp.116 translated coding region predicted by ESTScan from UniGene Afp.116

XSLERLRISKNHLSGSIPSRVWGLPLVQMIDLGDNGFSGGISSEIRMSTSLTQLLLQNNKFEGPLPSELGELTLLEKLSAYNNLFTGKVPAEIKKLKNLSSLHLEENSLTGSIPSEVGECIRLADLNLAKNELSGDIPKTLSSLSNLNSLNLSQNRLSGSIPWNLQRLKLSSIDLSGNKLMGRIPFDLAMTGGDQAFFGNAGLCIDNDLGDHVKSRKVSAREVKIIKALSNINCCWVVLYPWALVAIIAGLLLLSYKNFKLNESREESDLEGKLEKDPCWKLEAFHPMELDEDEICDLKDDNLIGSG


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
2-188 L domain-like,LRR

SLERLRISKNHLSGSIPSRVWGLPLVQMIDLGDNGFSGGISSEIRMSTSLTQLLLQNNKFEGPLPSELGELTLLEKLSAYNNLFTGKVPAEIKKLKNLSSLHLEENSLTGSIPSEVGECIRLADLNLAKNELSGDIPKTLSSLSNLNSLNLSQNRLSGSIPWNLQRLKLSSIDLSGNKLMGRIPFDL

ProfileScan: PS51450
IPR001611
2-25 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLERLRISKNHLSGSIPSRVWGLP

HMMPfam: PF00560
IPR001611
2-22 LRR_1
Leucine-rich repeat

SLERLRISKNHLSGSIPSRVW

Gene3D: G3DSA:3.80.10.10
3-185 no description

LERLRISKNHLSGSIPSRVWGLPLVQMIDLGDNGFSGGISSEIRMSTSLTQLLLQNNKFEGPLPSELGELTLLEKLSAYNNLFTGKVPAEIKKLKNLSSLHLEENSLTGSIPSEVGECIRLADLNLAKNELSGDIPKTLSSLSNLNSLNLSQNRLSGSIPWNLQRLKLSSIDLSGNKLMGRIP

HMMPanther: PTHR24420:SF112
3-307 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LERLRISKNHLSGSIPSRVWGLPLVQMIDLGDNGFSGGISSEIRMSTSLTQLLLQNNKFEGPLPSELGELTLLEKLSAYNNLFTGKVPAEIKKLKNLSSLHLEENSLTGSIPSEVGECIRLADLNLAKNELSGDIPKTLSSLSNLNSLNLSQNRLSGSIPWNLQRLKLSSIDLSGNKLMGRIPFDLAMTGGDQAFFGNAGLCIDNDLGDHVKSRKVSAREVKIIKALSNINCCWVVLYPWALVAIIAGLLLLSYKNFKLNESREESDLEGKLEKDPCWKLEAFHPMELDEDEICDLKDDNLIGSG

HMMPanther: PTHR24420
3-307 FAMILY NOT NAMED,FAMILY NOT NAMED

LERLRISKNHLSGSIPSRVWGLPLVQMIDLGDNGFSGGISSEIRMSTSLTQLLLQNNKFEGPLPSELGELTLLEKLSAYNNLFTGKVPAEIKKLKNLSSLHLEENSLTGSIPSEVGECIRLADLNLAKNELSGDIPKTLSSLSNLNSLNLSQNRLSGSIPWNLQRLKLSSIDLSGNKLMGRIPFDLAMTGGDQAFFGNAGLCIDNDLGDHVKSRKVSAREVKIIKALSNINCCWVVLYPWALVAIIAGLLLLSYKNFKLNESREESDLEGKLEKDPCWKLEAFHPMELDEDEICDLKDDNLIGSG

ProfileScan: PS51450
IPR001611
50-72 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTQLLLQNNKFEGPLPSELGEL

Seg: seg
94-109 seg

KKLKNLSSLHLEENSL

ProfileScan: PS51450
IPR001611
98-120 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSSLHLEENSLTGSIPSEVGEC

ProfileScan: PS51450
IPR001611
122-145 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLADLNLAKNELSGDIPKTLSSLS

Seg: seg
141-158 seg

LSSLSNLNSLNLSQNRLS

HMMPfam: PF00560
IPR001611
146-168 LRR_1
Leucine-rich repeat

NLNSLNLSQNRLSGSIPWNLQRL

ProfileScan: PS51450
IPR001611
146-169 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLNSLNLSQNRLSGSIPWNLQRLK

ProfileScan: PS51450
IPR001611
170-191 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LSSIDLSGNKLMGRIPFDLAMT

Seg: seg
243-254 seg

ALVAIIAGLLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox