PRGDB00065568 (Afp.137)

From PRG Wiki
Jump to: navigation, search
Afp.137
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71700571 (DR931208)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1122747 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1O809, mRNA sequence

DNA Sequence

AGTCACCATTGGAGATAGTTTAACAAAGTGACGATGAAATTGATCAGTTACAAATTTAGTCATATCAATACAAGATTCATCCCCACCCAATTCATACAATAAACATAGAAGTAACAGTAGTGCAGATAAACAAGCGCAATCCAATAAGAAAGTCTTACAAGCCACAATGCACAAGAACATAATGGGAAAAAAATACTTGATGGAGGTTGTATTCCTCTAATCCCTGTTTTGTCACCGCAGATCGAGGCTAAATGGTTGTTTTACTGTAAATGATGATGGAAGGAATGTGTTGGACAGTTGGCCAATCTTCACCTCCTTCTTTAACCCTTTGTTCAAATGATTTTGGCATATAGATGATTGTCAACTCTTGGAGCATAGTGAGAAATTTAAATCCTTGAGGAACCATCTTCAACTCTTCGCAAACCTGGATCAAACATTTAGTAAGACATGGCATGGCTCCTTCCTCTACTGTCCACTCCTCCAATTGATTGGAATACCCAATTCGTAAATTCTGAAGTTTGGGAAAACCTTTGGCAGAGCATACCATTTCTTTACCTAAGTATGAATTGGATAACTTAAGAAACACCAAGTGTGGTAGCTTCTCCAGAGTCGGCATCGGATCTTCAGAAAAATTAGTGAATCCAAGGTCTAATTTGATGAGATTTGATGGAAACAAGGAAGGGAGTTTCCAATTTTTAAACTTACCAGTCAATCTCAATTTCATTAAATGAATCTTTTCTGATAAAGATTCCAACAAATCCGAAGGAAATTCAATTGTATCAAGATACAACGACCGAAGCTTATCCAATCCACCACCACCAACAATTAATCGTATTGTTTTCTCATCTAATTCCACTATACCCAATTTCTCGAGATTTGTTAATTTCACAAGATCTAAA


Protein sequences

Name Description Sequence
Afp.137 translated coding region predicted by ESTScan from UniGene Afp.137

XLDLVKLTNLEKLGIVELDEKTIRLIVGGGGLDKLRSLYLDTIEFPSDLLESLSEKIHLMKLRLTGKFKNWKLPSLFPSNLIKLDLGFTNFSEDPMPTLEKLPHLVFLKLSNSYLGKEMVCSAKGFPKLQNLRIGYSNQLEEWTVEEGAMPCLTKCLIQVCEELKMVPQGFKFLTMLQELTIIYMPKSFEQRVKEGGEDWPTVQHIPSIIIYSKTTI

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
6-186 no description

KLTNLEKLGIVELDEKTIRLIVGGGGLDKLRSLYLDTIEFPSDLLESLSEKIHLMKLRLTGKFKNWKLPSLFPSNLIKLDLGFTNFSEDPMPTLEKLPHLVFLKLSNSYLGKEMVCSAKGFPKLQNLRIGYSNQLEEWTVEEGAMPCLTKCLIQVCEELKMVPQGFKFLTMLQELTIIYMP

superfamily: SSF52058
30-209 L domain-like,LRR

GGLDKLRSLYLDTIEFPSDLLESLSEKIHLMKLRLTGKFKNWKLPSLFPSNLIKLDLGFTNFSEDPMPTLEKLPHLVFLKLSNSYLGKEMVCSAKGFPKLQNLRIGYSNQLEEWTVEEGAMPCLTKCLIQVCEELKMVPQGFKFLTMLQELTIIYMPKSFEQRVKEGGEDWPTVQHIPSI

HMMPanther: PTHR23155:SF232
77-209 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

FPSNLIKLDLGFTNFSEDPMPTLEKLPHLVFLKLSNSYLGKEMVCSAKGFPKLQNLRIGYSNQLEEWTVEEGAMPCLTKCLIQVCEELKMVPQGFKFLTMLQELTIIYMPKSFEQRVKEGGEDWPTVQHIPSI

HMMPanther: PTHR23155
77-209 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FPSNLIKLDLGFTNFSEDPMPTLEKLPHLVFLKLSNSYLGKEMVCSAKGFPKLQNLRIGYSNQLEEWTVEEGAMPCLTKCLIQVCEELKMVPQGFKFLTMLQELTIIYMPKSFEQRVKEGGEDWPTVQHIPSI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox