PRGDB00065569 (Afp.156)

From PRG Wiki
Jump to: navigation, search
Afp.156
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74556326 (DT756324)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1190173 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XP78, mRNA sequence

DNA Sequence

GGAAGCGGTTTGGTGTATGTTCCAGGCCAAGATCGAAATGGAAGCTATCGTCCATTACAGTTAAGCAAAGGAATTTCTAGTGGAGCCATTGCTGGCATATCTATTGGTGGAATTGCTGCTGTGCTCCTTGTAGCAGTTTGTATATATGTTGGGATTTCCAGGAGGAAGAAGAGAGAGGTACCATTGCTCTCAGCAGGGTCGGAGGGTAACTCTAACCACCATGGACATGGTAGCGGGATTCCCTTGATTAAGACTTCAGAATTAGCTGCTCGAGCAGGTCGTCCTTCCCCCGGGCTTTCAGGTATCACAGTGGATAAGTCAGTGGAATTCTCATACGAAGAGCTGGCCCAGGCCACGGATAATTTTAGCTTGGCAAATAAAATTGGTCAAGGTGGCTTTGGAGCTGTTTACTATGCAGAGCTAAGAGGAGAGAAAGCTGCGATCAAGAAAATGGATATGCAAGCCACAAAGGAATTTCTTGCTGAGTTGAAGGTCTTAACACATGTTCATCATTTAAACCTGGTGCGCTTGATAGGTTATTGTGTTGAGGGTTCTTTGTTCCTAGTCTATGAATTCATTGAGAATGGAAACTTAAGTGAACATTTGCGTGGCTCAGCAAGGGAACCACTACCTTGGCCTACACGAGTGCAAATTGCCCTAGATTCGGCAAGAGGTCTTGAATATATTCATGAACATACAGTCCCTGTTTATATTCATCGTGATATTAAATCGGCCAACATCTTGATAGACAAGAATTATCATGGCAAGGTTGCAGATTTTGGACTTGCAAAACTAACTGAAGTTGGAAGTTCATTACAAACGCGGCTTGTGGGTACATTTGGATACATGCCCCCAGAGTATGCTCAGTATGGTGATGTTTCACCAAAGGTTGATGTCTATGCTTTCGGGGTCGTTCTTTATGAACTTATATCTGCAAAGGAAGCTATTGTAAAAGCAAATGGATC


Protein sequences

Name Description Sequence
Afp.156 translated coding region predicted by ESTScan from UniGene Afp.156

GSGLVYVPGQDRNGSYRPLQLSKGISSGAIAGISIGGIAAVLLVAVCIYVGISRRKKREVPLLSAGSEGNSNHHGHGSGIPLIKTSELAARAGRPSPGLSGITVDKSVEFSYEELAQATDNFSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKANGS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF421
1-316 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GSGLVYVPGQDRNGSYRPLQLSKGISSGAIAGISIGGIAAVLLVAVCIYVGISRRKKREVPLLSAGSEGNSNHHGHGSGIPLIKTSELAARAGRPSPGLSGITVDKSVEFSYEELAQATDNFSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAI

HMMPanther: PTHR24420
1-316 FAMILY NOT NAMED,FAMILY NOT NAMED

GSGLVYVPGQDRNGSYRPLQLSKGISSGAIAGISIGGIAAVLLVAVCIYVGISRRKKREVPLLSAGSEGNSNHHGHGSGIPLIKTSELAARAGRPSPGLSGITVDKSVEFSYEELAQATDNFSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAI

Seg: seg
24-40 seg

GISSGAIAGISIGGIAA

Seg: seg
66-79 seg

GSEGNSNHHGHGSG

superfamily: SSF56112
IPR011009
92-313 Protein kinase-like (PK-like)
Protein kinase-like domain

AGRPSPGLSGITVDKSVEFSYEELAQATDNFSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAK

Gene3D: G3DSA:3.30.200.20
106-179 no description

KSVEFSYEELAQATDNFSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIG

ProfileScan: PS50011
IPR000719
122-322 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKANGS

HMMSmart: SM00219
IPR020635
122-321 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKANG

HMMSmart: SM00220
IPR002290
122-316 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSLANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAI

HMMPfam: PF00069
IPR017442
124-313 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LANKIGQGGFGAVYYAELRGEKAAIKKMDMQATKEFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAK

PatternScan: PS00107
IPR017441
128-150 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGAVYYAELRGEKAAIKK

Gene3D: G3DSA:1.10.510.10
180-314 no description

YCVEGSLFLVYEFIENGNLSEHLRGSAREPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYHGKVADFGLAKLTEVGSSLQTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKE

PatternScan: PS00108
IPR008271
237-249 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

YIHRDIKSANILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox