PRGDB00065570 (Afp.169)

From PRG Wiki
Jump to: navigation, search
Afp.169
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71694585 (DR925222)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1116761 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1N681, mRNA sequence

DNA Sequence

CACTAGAAGATGTGATTGGTTACATCATGGGTTATCAACCTTGTAAATAGCTTCTGACCAAAATGGAAACATAAAGCTCAGACATGTATCAATGAAATTAAACCAAATATGTCGCCAGTAAGGGTTGATGTAGAGAACAATCACAAATCCAGCCAAGGTCATGATGTAAGAAGCTGCAAAACTTGCAAATAAGCTGATTAGATCCATCCCATAACTTGCACTCCACCTTGCAAGTGTGACGGTTGTTGATTCGGTAATGGTCTTGCATGGTTTCTGCAACGGCGGTCCACAAAGAAAAGGGTTGCCCTTGTAACTATTTTCATCAAATGTGCTGAACTGAGCTTTCATGTATGGAACCTCACCGGATAAGTTGTTGTATGACACATTGAAGACTGACAAAGTGTTTATATCAGTAAGCTCTGATGGGATTTTTCCAATCAACTTGTTACGAGAAAGATCCATGCTCTCAAGATGCTTCAATTTTGAGAAGGTTCTTGGAATTGATCCGGTTAACTGATTATTTGACAAGTTCAAAGCCATGATCATAGTTAGAACTCCTATATCATTTGGGATTAGGCCAGTGAATTGGTTGCATGACAAGTCAATCCCAGACAAGAAATTAAGAATGTCACCCTTGTAAGCGCCAGACCTACTCTTTGTCATGAACTCCACTTCTTCTTCTTCAGAATAAATCAAGTCCTCCAACATGTATTCCCTGCCCCTCATCTGTAAAAGATTTGATTGCCTCTCAAATCTAACATCTTAAGAGATGTCAAATTGTTGAAACATGGAGGAAG


Protein sequences

Name Description Sequence
Afp.169 translated coding region predicted by ESTScan from UniGene Afp.169

XSSMFQQFDISXDVRFERQSNLLQMRGREYMLEDLIYSEEEEVEFMTKSRSGAYKGDILNFLSGIDLSCNQFTGLIPNDIGVLTMIMALNLSNNQLTGSIPRTFSKLKHLESMDLSRNKLIGKIPSELTDINTLSVFNVSYNNLSGEVPYMKAQFSTFDENSYKGNPFLCGPPLQKPCKTITESTTVTLARWSASYGMDLISLFASFAASYIMTLAGFVIVLYINPYWRHIWFNFIDTCLSFMFPFWSEAIYKVDNP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
59-234 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LNFLSGIDLSCNQFTGLIPNDIGVLTMIMALNLSNNQLTGSIPRTFSKLKHLESMDLSRNKLIGKIPSELTDINTLSVFNVSYNNLSGEVPYMKAQFSTFDENSYKGNPFLCGPPLQKPCKTITESTTVTLARWSASYGMDLISLFASFAASYIMTLAGFVIVLYINPYWRHIWFN

HMMPanther: PTHR24420
59-234 FAMILY NOT NAMED,FAMILY NOT NAMED

LNFLSGIDLSCNQFTGLIPNDIGVLTMIMALNLSNNQLTGSIPRTFSKLKHLESMDLSRNKLIGKIPSELTDINTLSVFNVSYNNLSGEVPYMKAQFSTFDENSYKGNPFLCGPPLQKPCKTITESTTVTLARWSASYGMDLISLFASFAASYIMTLAGFVIVLYINPYWRHIWFN

Gene3D: G3DSA:3.80.10.10
61-176 no description

FLSGIDLSCNQFTGLIPNDIGVLTMIMALNLSNNQLTGSIPRTFSKLKHLESMDLSRNKLIGKIPSELTDINTLSVFNVSYNNLSGEVPYMKAQFSTFDENSYKGNPFLCGPPLQK

superfamily: SSF52058
62-178 L domain-like,LRR

LSGIDLSCNQFTGLIPNDIGVLTMIMALNLSNNQLTGSIPRTFSKLKHLESMDLSRNKLIGKIPSELTDINTLSVFNVSYNNLSGEVPYMKAQFSTFDENSYKGNPFLCGPPLQKPC

FPrintScan: PR00019
86-99 LEURICHRPT,Leucine-rich repeat signature

IMALNLSNNQLTGS

HMMPfam: PF13855
88-144 LRR_8,Leucine rich repeat

ALNLSNNQLTGSIPRTFSKLKHLESMDLSRNKLIGKIPSELTDINTLSVFNVSYNNL

FPrintScan: PR00019
107-120 LEURICHRPT,Leucine-rich repeat signature

LKHLESMDLSRNKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox