PRGDB00065571 (Afp.192)

From PRG Wiki
Jump to: navigation, search
Afp.192
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74553843 (DT754885)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1188734 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XH28, mRNA sequence

DNA Sequence

GAATGCTTGGAAAAAACTCTCAAGCACTATTACTAGCACTAGCACCATCCACAGGCAATAAATCTCTCAACATGGCAACAACCTGCAACATATTTGGTCTCCTTGAAGGAAAATCATCCACACATTGTAATGTTATCTCCATATACCTAGTTATTTCTTTAACTTCGGAGAGATCATTTTCATCGCTCTTGGACAAAAGAGCTGGATCAATTACTTCTTTTCCCTTCCCTTCTCTCACTTTCATCTTCACCCATCCAACTAAATTGGTATCACCAAAATCATCCTTATCGGTTGGTCGCTTCCCTGTCAAGAGTTCTAACATAACAACTCCAAATGAATAAACATCACCCTTGGCAGTGCACCTAAAGCTCTGGTAATACTCTGGTGGAACATAACCAGGAGTTCCTGCCAGCGTGCTAACACTTAGATGTGTGTCGAGTGCACTAATGAGCCTTGCCATTCCAAAATCTGATACTCTTGCTTCCATTTCATGATCTAAAAGCACATTACTTGACTTCATATCACGGTGTATAATATGTGGAATGCAGTTGTGGTGCAAAAAGCAAAGACCTTTAGCTGCTCCTCTCGCAATCTTTTTCCTCTCTTCCCATGTCAATATTCTTCCTTCCCTTGTTTTCATCTTCCCGTGAAGCATGTCTTCGAGGCTCCCGAATTGCATGAACTCATATACAAGAAGTCTCTCCTCACCAATCTTGCAATAACCCATTAAAGGGACAAGATTTTTGTGCTTGATCTTCCCCAGAGTTTCCATCTCTGCCATAAATTCTCGGTCACCTTGGCAACTGAGGCGTATAAGTTTCTTAATTGCAACACTCGAGCCATCTTTCATTGTTGCCTTGAACACTTCTCCAAACCCACCAGAACCGATTAAGCTTGCTGCTGCAAATCCATTAGTGGCCTCAATAAGTTGTGAGAACTTGAGCTTTCTCAG


Protein sequences

Name Description Sequence
Afp.192 translated coding region predicted by ESTScan from UniGene Afp.192

LRKLKFSQLIEATNGFAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAMLRDLLPVDGASASNSA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF924
1-298 SUBFAMILY NOT NAMED

LRKLKFSQLIEATNGFAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAMLRDL

HMMPanther: PTHR24420
1-298 FAMILY NOT NAMED,FAMILY NOT NAMED

LRKLKFSQLIEATNGFAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAMLRDL

superfamily: SSF56112
IPR011009
2-293 Protein kinase-like (PK-like)
Protein kinase-like domain

RKLKFSQLIEATNGFAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVA

Gene3D: G3DSA:3.30.200.20
2-91 no description

RKLKFSQLIEATNGFAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEF

ProfileScan: PS50011
IPR000719
16-299 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAMLRDLL

HMMSmart: SM00220
IPR002290
16-299 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAMLRDLL

HMMSmart: SM00219
IPR020635
16-295 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAAASLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAML

HMMPfam: PF00069
IPR017442
20-292 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SLIGSGGFGEVFKATMKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHKNLVPLMGYCKIGEERLLVYEFMQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVV

PatternScan: PS00107
IPR017441
22-45 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGFGEVFKATMKDGSSVAIKK

Gene3D: G3DSA:1.10.510.10
92-295 no description

MQFGSLEDMLHGKMKTREGRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDHEMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSFGVVMLELLTGKRPTDKDDFGDTNLVGWVKMKVREGKGKEVIDPALLSKSDENDLSEVKEITRYMEITLQCVDDFPSRRPNMLQVVAML

PatternScan: PS00108
IPR008271
140-152 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDMKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox