PRGDB00065574 (Afp.387)

From PRG Wiki
Jump to: navigation, search
Afp.387
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74522309 (DT735280)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1169130 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1TW63, mRNA sequence

DNA Sequence

AAGAAACGTTCATCCAGCAAAGTAGGTCTTCTACTCGGTACCATCGGGGCAGTTCTGGGAGGTCTAATGGTGCTGTGTTTGATAGCATTTATAATCTTCTGGAAGTTGGGAGCAAGAGAAACGGAAAACAACACGTCTAAAAATTCAGTGGCAGGGAAGTCCTTTAACGGTCTCTCACCCAAACTAGTAACTGATGCAAGAAATGTGTCTTCTGCAATGATGTTTGGGGCACTAGGGCTTCCACAATATCATGTTTTCAGTTTGGAAGAAATTGAAGAAGCAACAAACAATTTTAATTCATCATATTTGATAGAAGGGTCTCAGGGTCAGATGTATAAAGCTCGGCTTACAGATGGTTCAGTGGCAGTGGTGAAATGTTTGAAATTGAAGCAGAAGCATTCCCCGCACACCTTAGGAAGACATATGGAAGTGTTATCAAAGCTCCGACATCAGCATTTGGTTAGCATTCTTGGACACACTCTCATCACTCACCAAGAACACCCTCATGCAGCAAACACCTTTCTTGTCTTTGAGTATGTTTCAAATGGAACACTACGGAGCCATCTTACTGACCCAAGAAAGCGAGAGGCACTTAAATGGCCAGAGAGAATGGCAGTTACCATTGGTGTTGCAAGGGGAATCCAGTTCTTGCACTCCGGTGTTACACCCGGTCTTTTTGGGAACAATCTAAAAACAGAGAACATATTGCTTGATGAGAATCTAAAAGCAAAAATTAGCAACTATAATATACCTCTGTCGTCTATGGTAGAGTCAGAAAGTCCTTACAATGGAGATGAAACAGCTAATTATCATAACAGCAATATGCATAGTGCTGAAGATGGGGCGCCGCAAGATGTTTATCAGTTGGGCAGTATTTACTAGAACTTATCACAGGAAACAGATTACATCCCAGAGTCAACTGGATGTGCATAGACTCAGCTAGAGCAGTTTAGCAGATAGCCATCAGACTGCATGATGTGATGCGTCATACGCACACTTTCGCTTATGATCATAGACAA


Protein sequences

Name Description Sequence
Afp.387 translated coding region predicted by ESTScan from UniGene Afp.387

KKRSSSKVGLLLGTIGAVLGGLMVLCLIAFIIFWKLGARETENNTSKNSVAGKSFNGLSPKLVTDARNVSSAMMFGALGLPQYHVFSLEEIEEATNNFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESESPYNGDETANYHNSNMHSAEDGGAARCLSVGQYLLELITGNRLHPRVNWMCIDSARAVXQIAIRLHDVMRHTHTFAYDHRQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF465
1-260 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KKRSSSKVGLLLGTIGAVLGGLMVLCLIAFIIFWKLGARETENNTSKNSVAGKSFNGLSPKLVTDARNVSSAMMFGALGLPQYHVFSLEEIEEATNNFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESES

HMMPanther: PTHR24420
1-260 FAMILY NOT NAMED,FAMILY NOT NAMED

KKRSSSKVGLLLGTIGAVLGGLMVLCLIAFIIFWKLGARETENNTSKNSVAGKSFNGLSPKLVTDARNVSSAMMFGALGLPQYHVFSLEEIEEATNNFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESES

superfamily: SSF56112
IPR011009
70-248 Protein kinase-like (PK-like)
Protein kinase-like domain

SSAMMFGALGLPQYHVFSLEEIEEATNNFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNY

Gene3D: G3DSA:3.30.200.20
82-175 no description

QYHVFSLEEIEEATNNFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFL

ProfileScan: PS50011
IPR000719
97-340 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESESPYNGDETANYHNSNMHSAEDGGAARCLSVGQYLLELITGNRLHPRVNWMCIDSARAVXQIAIRLHDVMRHTHTFAYDHRQ

HMMSmart: SM00220
IPR002290
97-306 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESESPYNGDETANYHNSNMHSAEDGGAARCLSVGQYLLELITGNRLHPRV

HMMSmart: SM00219
IPR020635
97-320 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

NFNSSYLIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESESPYNGDETANYHNSNMHSAEDGGAARCLSVGQYLLELITGNRLHPRVNWMCIDSARAVXQI

HMMPfam: PF07714
IPR001245
103-262 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LIEGSQGQMYKARLTDGSVAVVKCLKLKQKHSPHTLGRHMEVLSKLRHQHLVSILGHTLITHQEHPHAANTFLVFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYNIPLSSMVESESPY

Gene3D: G3DSA:1.10.510.10
176-249 no description

VFEYVSNGTLRSHLTDPRKREALKWPERMAVTIGVARGIQFLHSGVTPGLFGNNLKTENILLDENLKAKISNYN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox