PRGDB00065575 (Afp.499)

From PRG Wiki
Jump to: navigation, search
Afp.499
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74529150 (DT739160)
Gene Class Unknown
Domain Type
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1173009 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1UL72, mRNA sequence

DNA Sequence

TCGATATATTGCATCTGTAAAAGCTACAAAGACAAGTGTGACTCACTGCTATCGAAAGCGTTGATGGGAAGGCATAGGAGATTGGGAGGGAGCTAAGATTGTAAATTTCCATTTTCCAGGAAGCCTTTTTCTCTGAGGCTCTCCACTGCTTCTCGGACTGCATCCTCAATTGGTGTAAATACCAGGCCCAGATCAATTAGTCTCTTAGCTGCATCTTTGCACCCCATCAAACCCGGTTGTGTTTCTTCGTTGAACCTGTGAATGGGAAATTGAGGGTAGAGTTTGGAGACAGTATGGGCGAAATCACGGAACTGATAGATGCCGTTGGTGCAGAGGTACCTCCCAGAAGCAGAGGGAGTCTCAAAAAGAAGCAGTTGGGCTTTGGCAACGTCTCTGACATGAACAGCGCCCAGCCAATGATACTCTTGTGTGTCCTTAGATCCCTGTAGCATATGTAGCAGAACGGCAGAACTGGCATTCAAAGAAGGCTGGAGAAGAGAACCTAGACAAGTGGAAGGATGGATTGCAACAACATCGATATCATTGTTTTTGGAATATTCCCAAGCAGCTTTCTCAGCCAATGTTTTTGATACTGGATACCATTTCTGATGGGATTTGCAGTAGTCGAGATCGGTCCAAGAGGTCTCGTTGAAAGGAATGGAGTTGTTGGGCCATGCTGGGTTTGGGACTAGGGCTGAGATGGAAGATGTTAAGACCACCCTCCTGACTGTTCCCGCTAAGGATGCTGCTTGGAGAACAGCTGGGACAATAAGCTCCAAATAGGGATCTTTAGGATCATCCAAGCTGCAAGGTGATGCCACGTGGAAAACACCATGGCAACCATGAACAGCTTTACAGATAGCCTCTTTGTCAAGG


Protein sequences

Name Description Sequence
Afp.499 translated coding region predicted by ESTScan from UniGene Afp.499

XLDKEAICKAVHGCHGVFHVASPCSLDDPKDPYLELIVPAVLQAASLAGTVRRVVLTSSISALVPNPAWPNNSIPFNETSWTDLDYCKSHQKWYPVSKTLAEKAAWEYSKNNDIDVVAIHPSTCLGSLLQPSLNASSAVLLHMLQGSKDTQEYHWLGAVHVRDVAKAQLLLFETPSASGRYLCTNGIYQFRDFAHTVSKLYPQFPIHRFNEETQPGLMGCKDAAKRLIDLGLVFTPIEDAVREAVESLREKGFLENGNLQSXLPPNLLCLPINAFDSSESHLSLXLLQMQYIX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
2-256 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

LDKEAICKAVHGCHGVFHVASPCSLDDPKDPYLELIVPAVLQAASLAGTVRRVVLTSSISALVPNPAWPNNSIPFNETSWTDLDYCKSHQKWYPVSKTLAEKAAWEYSKNNDIDVVAIHPSTCLGSLLQPSLNASSAVLLHMLQGSKDTQEYHWLGAVHVRDVAKAQLLLFETPSASGRYLCTNGIYQFRDFAHTVSKLYPQFPIHRFNEETQPGLMGCKDAAKRLIDLGLVFTPIEDAVREAVESLREKGFLEN

HMMPanther: PTHR10366
2-256 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

LDKEAICKAVHGCHGVFHVASPCSLDDPKDPYLELIVPAVLQAASLAGTVRRVVLTSSISALVPNPAWPNNSIPFNETSWTDLDYCKSHQKWYPVSKTLAEKAAWEYSKNNDIDVVAIHPSTCLGSLLQPSLNASSAVLLHMLQGSKDTQEYHWLGAVHVRDVAKAQLLLFETPSASGRYLCTNGIYQFRDFAHTVSKLYPQFPIHRFNEETQPGLMGCKDAAKRLIDLGLVFTPIEDAVREAVESLREKGFLEN

superfamily: SSF51735
2-250 NAD(P)-binding Rossmann-fold domains

LDKEAICKAVHGCHGVFHVASPCSLDDPKDPYLELIVPAVLQAASLAGTVRRVVLTSSISALVPNPAWPNNSIPFNETSWTDLDYCKSHQKWYPVSKTLAEKAAWEYSKNNDIDVVAIHPSTCLGSLLQPSLNASSAVLLHMLQGSKDTQEYHWLGAVHVRDVAKAQLLLFETPSASGRYLCTNGIYQFRDFAHTVSKLYPQFPIHRFNEETQPGLMGCKDAAKRLIDLGLVFTPIEDAVREAVESLRE

Gene3D: G3DSA:3.40.50.720
IPR016040
3-201 no description
NAD(P)-binding domain

DKEAICKAVHGCHGVFHVASPCSLDDPKDPYLELIVPAVLQAASLAGTVRRVVLTSSISALVPNPAWPNNSIPFNETSWTDLDYCKSHQKWYPVSKTLAEKAAWEYSKNNDIDVVAIHPSTCLGSLLQPSLNASSAVLLHMLQGSKDTQEYHWLGAVHVRDVAKAQLLLFETPSASGRYLCTNGIYQFRDFAHTVSKLY

HMMPfam: PF01370
IPR001509
3-181 Epimerase
NAD-dependent epimerase/dehydratase

DKEAICKAVHGCHGVFHVASPCSLDDPKDPYLELIVPAVLQAASLAGTVRRVVLTSSISALVPNPAWPNNSIPFNETSWTDLDYCKSHQKWYPVSKTLAEKAAWEYSKNNDIDVVAIHPSTCLGSLLQPSLNASSAVLLHMLQGSKDTQEYHWLGAVHVRDVAKAQLLLFETPSASGRY

Seg: seg
256-273 seg

NGNLQSXLPPNLLCLPIN

Seg: seg
277-287 seg

SSESHLSLXLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox