PRGDB00065576 (Afp.539)

From PRG Wiki
Jump to: navigation, search
Afp.539
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74526862 (DT737817)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1171666 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1UB78, mRNA sequence

DNA Sequence

GAACACCTACTGCTAGTTACATTCTTTTATTGTACACTCGGAATCTGTACAAATATTGAATTCAATCCATAAAACCAATGTTCATCTGAAATTGACAGCAATAACTCCCTTGAACTGCACAGAACAAGCATTTTGAAAGCAATATACGGCACCTGCATCACTATCAGCAGCCAATCGAGCAAACCCAAAGTCAGCCACCTTGGCTCGAAGGTTTTCTGTGAGAAGGATGTTTGAAGACTTGATGTCTCTGTGGATAATGGGGTGATCTGTATACATGTGGAGATAGGTAACTGCATGAGCAACATCAATAGCAATATCCAGCCGAGCAGCAAGGTCCAGAATGTTTCCACTCAAACAATCCAAATGTTCTCTGAGAGTTCCATTGGGAACATACTCCACCACAACGATCTTTTCATCTTCGTGCTCCAAGTACCCGTGGCATCTGACCAAATTCATATGCTCCACTCGTGCCAGCATTTTTATCTCACTTTGGAATTCTATGCCTATATGCTTATCATATACATTCTTCTTTGCACGTTTAACTGCAACAAATGTGCCATCTTCCAATCTTCCTTTATACACAGTCCCAAAACCACCTTGTCCTATCTTCAAGGAAGGAGAAAAATTCCTGGTAGCCTTGTATATCTCCGCTATTGTGAATTTCAAACTCCCGGGTTCCTTTGTTTGGGTGGAATTATTGGAGCTGGAATATATCCCTCGTCTGGAACTGGGCTTCGTAGAACTACCAGAACTTGATATATCCGACACAACAGAAGGTGGTTCAGAATCACCAAAATTAGAAGAAGATTTAGTTTCCGGTGGAGTGAAACAAGAAGTAATAGCTCCGGCAACAGATCTAACAGCAACTTTAATTCGATTCCGGTCAACAGATGATTTGCCACCATTAGATGAACTTGAAGATATATAACTATCAGTTAATTCTGATCGATCAGTGTTTTCAAACCATCGGAACTAAAACGTTTCGACTACTCCACC


Protein sequences

Name Description Sequence
Afp.539 translated coding region predicted by ESTScan from UniGene Afp.539

GGVVETFXFRWFENTDRSELTDSYISSSSSNGGKSSVDRNRIKVAVRSVAGAITSCFTPPETKSSSNFGDSEPPSVVSDISSSGSSTKPSSRRGIYSSSNNSTQTKEPGSLKFTIAEIYKATRNFSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDAGAVYCFQNACSVQFKGVIAVNFR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF813
16-281 SUBFAMILY NOT NAMED

DRSELTDSYISSSSSNGGKSSVDRNRIKVAVRSVAGAITSCFTPPETKSSSNFGDSEPPSVVSDISSSGSSTKPSSRRGIYSSSNNSTQTKEPGSLKFTIAEIYKATRNFSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDA

HMMPanther: PTHR24420
16-281 FAMILY NOT NAMED,FAMILY NOT NAMED

DRSELTDSYISSSSSNGGKSSVDRNRIKVAVRSVAGAITSCFTPPETKSSSNFGDSEPPSVVSDISSSGSSTKPSSRRGIYSSSNNSTQTKEPGSLKFTIAEIYKATRNFSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDA

Seg: seg
18-36 seg

SELTDSYISSSSSNGGKSS

Seg: seg
71-91 seg

SEPPSVVSDISSSGSSTKPSS

Gene3D: G3DSA:2.60.120.200
IPR013320
83-143 no description
Concanavalin A-like lectin/glucanase, subgroup

SGSSTKPSSRRGIYSSSNNSTQTKEPGSLKFTIAEIYKATRNFSPSLKIGQGGFGTVYKGR

superfamily: SSF56112
IPR011009
97-280 Protein kinase-like (PK-like)
Protein kinase-like domain

SSSNNSTQTKEPGSLKFTIAEIYKATRNFSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSD

ProfileScan: PS50011
IPR000719
125-304 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDAGAVYCFQNACSVQFKGVIAVNFR

HMMSmart: SM00219
IPR020635
125-303 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDAGAVYCFQNACSVQFKGVIAVNF

HMMSmart: SM00220
IPR002290
125-303 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPSLKIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDAGAVYCFQNACSVQFKGVIAVNF

HMMPfam: PF00069
IPR017442
130-276 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KIGQGGFGTVYKGRLEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDEKIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLA

PatternScan: PS00107
IPR017441
131-157 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGTVYKGRLEDGTFVAVKRAKK

Gene3D: G3DSA:3.30.200.20
144-195 no description

LEDGTFVAVKRAKKNVYDKHIGIEFQSEIKMLARVEHMNLVRCHGYLEHEDE

Gene3D: G3DSA:1.10.510.10
196-281 no description

KIVVVEYVPNGTLREHLDCLSGNILDLAARLDIAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENLRAKVADFGFARLAADSDA

PatternScan: PS00108
IPR008271
247-259 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox