PRGDB00065577 (Afp.551)

From PRG Wiki
Jump to: navigation, search
Afp.551
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71710660 (DR941297)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1132836 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Q428, mRNA sequence

DNA Sequence

TGCCTACCTTAATTGCAAAAATATCAACTAAAGTGCCAATACATAATTTAAGAAAAGACCACAAAGCTGCGGTCATAGCCTTTGTCAATGGTAGCAGAGGCTTTCAAATAAACCTATGTAATTCCAAGAATTACTGTACAAGGCTAGTGTTTACCTTTCATCAACTTCTACATTAACCTCTGGAACTACCTCTAGTATTGATGGTAGCATTGAAAAACTAGAGGACTGGCCAAACTGAAATGGATAGGGAGGCTTCTTAACAGGTATTTCATTCTCAAGCACGAATACAACCTGGTTCATTGAAGGTCTTATTTCAGGATTATAATGAGAGCACCATAATGCAACCGTAGCTAATAACTTTGCTCTCCCTCTTTCTTTCTCTGTGATCTCACAGTCCTTTATAAGTTGGTCTAGCTGTCCATTATTAAACTTCTGCCAAACTTGTTCTGGAAACCAGTTTTCGCATTCTCCATTGCTTCTCCTCCCTAAAATTTCAAACAACATCATGCCAAAGCTGTAAACATCACATTTGTAAGTTACGCGTGATCCCGGCAACCACGTCTCTGGGGCATTATAACCTTGAGTGCCTCTGGTTCTGGTCAAGGGAACTTGCGACATACCCCGTTTCATAAGCTTTGATAATCCAAAATCTGTAATTCTAGGCGAAAAATTCTTGTCAAGGAGCACATTACCAGCCTTTATGTCATAGTGAATTATTCGTTCATCCCTACCATCGTGCAAATAAAGAAGCCCCCTTGCAGTCTGCACTGCAATGCTATAGAATGTCTCCCAGTCTATACCGCCATGGTGGTTCTCGTACAAAATCTTATCCAAAGAACCATTTTCCATATATTCATAAACAAGTGCTTTTATGTTCTGCTCAAAGCAATACCCATAGAGTTTCA


Protein sequences

Name Description Sequence
Afp.551 translated coding region predicted by ESTScan from UniGene Afp.551

XKLYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVFVLENEIPVKKPPYPFQFGQSSSFSMLPSILEVVPEVNVEVDER

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-224 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XKLYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVFVLENEIPVKKPPYPFQ

HMMSmart: SM00219
IPR020635
1-210 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XKLYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVFVL

HMMPanther: PTHR24420
2-243 FAMILY NOT NAMED,FAMILY NOT NAMED

KLYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVFVLENEIPVKKPPYPFQFGQSSSFSMLPSILEVVPE

superfamily: SSF56112
IPR011009
2-224 Protein kinase-like (PK-like)
Protein kinase-like domain

KLYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVFVLENEIPVKKPPYPFQ

HMMSmart: SM00220
IPR002290
2-209 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KLYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVFV

HMMPfam: PF00069
IPR017442
3-206 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LYGYCFEQNIKALVYEYMENGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQV

Gene3D: G3DSA:1.10.510.10
22-208 no description

NGSLDKILYENHHGGIDWETFYSIAVQTARGLLYLHDGRDERIIHYDIKAGNVLLDKNFSPRITDFGLSKLMKRGMSQVPLTRTRGTQGYNAPETWLPGSRVTYKCDVYSFGMMLFEILGRRSNGECENWFPEQVWQKFNNGQLDQLIKDCEITEKERGRAKLLATVALWCSHYNPEIRPSMNQVVF

PatternScan: PS00108
IPR008271
64-76 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHYDIKAGNVLL

Seg: seg
239-250 seg

EVVPEVNVEVDE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox