PRGDB00065578 (Afp.552)

From PRG Wiki
Jump to: navigation, search
Afp.552
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74555085 (DT755596)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1189445 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XL47, mRNA sequence

DNA Sequence

TAGACCAAGATTCCCACCACCTCTACCACTTCCTCTTCCTCTCCCTAACAATAACAACTCTTCTTTCTCTACCGTCGATCGTCTATCAGATCTTGAGAAATTACAAGTTCTTGGTCATGGAAATAGTGGTACCGTTTACAAAGTAAGACATAAGCGCACGTTAGCAACTTATGCATTAAAAGTGATCCATGGAGATTGTGATACTACTGTACGCCGACAGATCTTTCGTGAGATGGAGATTCTTCGTCGTACAGATTCTCCTTATGTTGTTAGTTGCAATGGAATCTTCGAAAAATCACCAGGAGATATCGCGATTCTGTTAGAATATATGGATTCGGTTACACTGGATAATGTACTCCGCATTAACGGAACTTTCTCGGAATCTTCTTTGGCGAATGTTGCTCTTCAAGTTCTTAACGGTCTTAACTATCTTCACACACATAAGATTGTTCATCGGGATATAAAACCGTCAAATCTTCTTGTTAATTCGAAGATGGAAGTCAAAATAGCTGACTTTGGAGTCAGTAAAATCATGTGCCGTTCACTTGATCCTTGTGATTCGTATGTTGGCACGTGTGCTTATATGAGTCCAGAAAGATTTGATCCAGATACTTATGGTGCTAATTATAATGGTTATGCTGGTGATATTTGGAGCTTAGGGCTCACGTTAGTAGAACTCTATGTTGGTCACTTTCCATTTTCACCACCAGGACAAAAACCTGATTGGGCTTCACTAATGTGCGCAATATGTTTTAGTGATCCACCTAGTTTGCAAGAAAGTTCAGCTTCAGAAGAG


Protein sequences

Name Description Sequence
Afp.552 translated coding region predicted by ESTScan from UniGene Afp.552

XRPRFPPPLPLPLPLPNNNNSSFSTVDRLSDLEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPGQKPDWASLMCAICFSDPPSLQESSASEE

Domains

Domain Start-End Description Sequence

Seg: seg
6-20 seg

PPPLPLPLPLPNNNN

HMMPanther: PTHR24361:SF31
7-266 SUBFAMILY NOT NAMED

PPLPLPLPLPNNNNSSFSTVDRLSDLEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPGQKPDWASLMCAICFSDPPSLQESSASEE

HMMPanther: PTHR24361
7-266 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

PPLPLPLPLPNNNNSSFSTVDRLSDLEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPGQKPDWASLMCAICFSDPPSLQESSASEE

superfamily: SSF56112
IPR011009
18-234 Protein kinase-like (PK-like)
Protein kinase-like domain

NNNSSFSTVDRLSDLEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPF

Gene3D: G3DSA:3.30.200.20
21-138 no description

SSFSTVDRLSDLEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQV

ProfileScan: PS50011
IPR000719
32-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPGQKPDWASLMCAICFSDPPSLQESSASEE

HMMSmart: SM00220
IPR002290
32-264 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPGQKPDWASLMCAICFSDPPSLQESSAS

HMMSmart: SM00219
IPR020635
32-265 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LEKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPGQKPDWASLMCAICFSDPPSLQESSASE

HMMPfam: PF00069
IPR017442
33-238 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKLQVLGHGNSGTVYKVRHKRTLATYALKVIHGDCDTTVRRQIFREMEILRRTDSPYVVSCNGIFEKSPGDIAILLEYMDSVTLDNVLRINGTFSESSLANVALQVLNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPG

PatternScan: PS00107
IPR017441
38-61 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGNSGTVYKVRHKRTLATYALK

Gene3D: G3DSA:1.10.510.10
139-238 no description

LNGLNYLHTHKIVHRDIKPSNLLVNSKMEVKIADFGVSKIMCRSLDPCDSYVGTCAYMSPERFDPDTYGANYNGYAGDIWSLGLTLVELYVGHFPFSPPG

PatternScan: PS00108
IPR008271
150-162 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPSNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox