PRGDB00065579 (Afp.564)

From PRG Wiki
Jump to: navigation, search
Afp.564
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74557672 (DT757296)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1191145 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XW21, mRNA sequence

DNA Sequence

TAAAGGGAATCCCAGAAAGAATATGTGTGTTAAGGGAGAAAGACAACAAGGACACTAGAAAGAAAACATACATTATAACAGACCTACATGAAGAAAATCAATAAAACAACTTATGAACAAGACTAGGTCCCCTCCTATCACACCACCACCTTCTCTTGGTTGTTTTGTTATGTTTTTACCTCCCATCAGCAGATGTGAATGAATCAGCAAAACCTGAAGGACGAGTAGGTATGCTTGTCTGTGTGTTATCAACACTAGCAAGAAACGAAGATGAATCTTGTCCCATTGCGGAGTTTCCATCAAGGGCCTGCCACTTTTTAAGTTGTTGGGCTAGGCTCAACTCCATGTCAATGGCATAGGGATCCTCAGGATCTGTGTCTGATGGCTTCCAAAGTTCCACATAGGATGACAGCACATTGACGACATGCCCCATGTCGGGTCTCTGATGGGGTTCTCTTGAACAACAGTAGCCAGCTAGTTCAGATATCGTGCTAATGCTTGCCAAGCCGCCCTCATCGTCAATGTCAATTGTTGGATCAACTGCTTTTCGGAAGGTGTCTTTGTTAATACACATTCTTCGAAACCATGTAACTAAGTGCATACTCTCTTCGGGTTGACTTTCATCAAGTGCCTTTCTTCCTGTTATCAACTCCATAAGAATCACCCCAAAGGCATACACGTCTACCTTAGTTGTCACTCGCCCCGTTGCTGCATACTCTGGAGCAAGGTACCCAAAGGTTCCTGCGAGTCTTGTTTCAATAGATGCTTTCCCTTCGGGAGCAAGGCGAACAAGCCCGAAATCCGCAACCTTTGCTCTCATATCATCACCTAAAAGAATGTTAGAGGGCT


Protein sequences

Name Description Sequence
Afp.564 translated coding region predicted by ESTScan from UniGene Afp.564

XPSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVNVLSSYVELWKPSDTDPEDPYAIDMELSLAQQLKKWQALDGNSAMGQDSSSFLASVDNTQTSIPTRPSGFADSFTSADGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-151 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVNVLSSYV

HMMPfam: PF00069
IPR017442
2-145 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVN

Gene3D: G3DSA:1.10.510.10
2-171 no description

PSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVNVLSSYVELWKPSDTDPEDPYAIDMEL

HMMPanther: PTHR24420:SF467
2-211 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVNVLSSYVELWKPSDTDPEDPYAIDMELSLAQQLKKWQALDGNSAMGQDSSSFLASVDNTQTSIPTRP

HMMPanther: PTHR24420
2-211 FAMILY NOT NAMED,FAMILY NOT NAMED

PSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVNVLSSYVELWKPSDTDPEDPYAIDMELSLAQQLKKWQALDGNSAMGQDSSSFLASVDNTQTSIPTRP

superfamily: SSF56112
IPR011009
2-170 Protein kinase-like (PK-like)
Protein kinase-like domain

PSNILLGDDMRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGRKALDESQPEESMHLVTWFRRMCINKDTFRKAVDPTIDIDDEGGLASISTISELAGYCCSREPHQRPDMGHVVNVLSSYVELWKPSDTDPEDPYAIDME






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox