PRGDB00065580 (Afp.592)

From PRG Wiki
Jump to: navigation, search
Afp.592
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74524228 (DT736332)
Gene Class N
Domain Type NBS
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1170181 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1U302, mRNA sequence

DNA Sequence

GATTTATGCTATTACCAACTCTCCTTCTCAGTGGTGTTGGTTTTCATTAATGGAGATTGAGAACACAAGTGCAAGTGTTGATACAGGTTTTACATTTAGGAGAGATGAATCTGCGGCATTCTTGGTGTGGGAAGATTTGAATGTAGCGCTTAACAGCTTCGGAGATGGTCCAACGAAAAGGATACTCCATGGACTTACTGGGTGTGCTGAACCTGGTAGGATTTTGGGTATTATGGGTCCTTCAGGATCAGGCAAATCTACTCTTCTTGATTCTTTGGCAGGGAGACTCTCAAGTAATGTGATTATGACTGGAAGTATTCTACTCAATGGAAAGAAAAGAAGGCTTGGTTATGGATCCTTTGCTTATGTAACTCAAGAAGATGTATTGTTAGGCACTCTGTCAGTTAGAGAAACTATTACTTACTCTGCTCATTTGAGACTTCCAAGTAGCATGAGCAAAGGAGACATAATGGGAATAGTAGACAACACTATTATGGAAATGGGACTTCAAGATTGTGCAGATACAGTGGTTGGTAATTGGCATTTAAGAGGTCTAAGTGGTGGAGAGAAGAAGAGATTAAGTATTGCTTTAGAAATTCTTACAAGGCCTCCTCTTTTGTTTCTTGATGAACCTACAAGTGGACTTGATAGTGCATCAGCTTTCTTTGTTATTCAAACTATAAGAAACATAGCTCGCGATGGAAGAACTGTTGTATCTTCTATTCATCAACCTAGTAGTGAAGTTTTCGCACAATTTGATGATTTGGTCCTTCTTTCGGGTGGTGAAACTGTTTATTTTGGTGACGCAAAGATGGCTGTCCAGTTCTTTGCTGAAGCTGGATTCCCTTGTCCAAGCAGAGAAACCCTTCTGATCATTTCCTTCGATGTATCACACAGATTTTGACGTGTTACTGCACTCTATAGGATCTCAAGA


Protein sequences

Name Description Sequence
Afp.592 translated coding region predicted by ESTScan from UniGene Afp.592

XIYAITNSPSQWCWFSLMEIENTSASVDTGFTFRRDESAAFLVWEDLNVALNSFGDGPTKRILHGLTGCAEPGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIHQPSSEVFAQFDDLVLLSGGETVYFGDAKMAVQFFAEAGFPCPSRETLLIISFDVSHRFXRVTALYRISR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF20
34-287 ATP-BINDING CASSETTE TRANSPORTER PLANT,ATP-BINDING CASSETTE TRANSPORTER PLANT

RRDESAAFLVWEDLNVALNSFGDGPTKRILHGLTGCAEPGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIHQPSSEVFAQFDDLVLLSGGETVYFGDAKMAVQFFAEAGFPCPSR

HMMPanther: PTHR19241
34-287 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

RRDESAAFLVWEDLNVALNSFGDGPTKRILHGLTGCAEPGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIHQPSSEVFAQFDDLVLLSGGETVYFGDAKMAVQFFAEAGFPCPSR

superfamily: SSF52540
41-290 P-loop containing nucleoside triphosphate hydrolases

FLVWEDLNVALNSFGDGPTKRILHGLTGCAEPGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIHQPSSEVFAQFDDLVLLSGGETVYFGDAKMAVQFFAEAGFPCPSRETL

ProfileScan: PS50893
IPR003439
42-286 ABC_TRANSPORTER_2
ABC transporter-like

LVWEDLNVALNSFGDGPTKRILHGLTGCAEPGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIHQPSSEVFAQFDDLVLLSGGETVYFGDAKMAVQFFAEAGFPCPS

Gene3D: G3DSA:3.40.50.300
44-271 no description

WEDLNVALNSFGDGPTKRILHGLTGCAEPGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIHQPSSEVFAQFDDLVLLSGGETVYFGDAK

HMMSmart: SM00382
IPR003593
72-243 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGRILGIMGPSGSGKSTLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTSGLDSASAFFVIQTIRNIARDGRTVVSSIH

HMMPfam: PF00005
IPR003439
87-214 ABC_tran
ABC transporter-like

STLLDSLAGRLSSNVIMTGSILLNGKKRRLGYGSFAYVTQEDVLLGTLSVRETITYSAHLRLPSSMSKGDIMGIVDNTIMEMGLQDCADTVVGNWHLRGLSGGEKKRLSIALEILTRPPLLFLDEPTS

PatternScan: PS00211
IPR017871
186-200 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGEKKRLSIALEI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox