PRGDB00065581 (Afp.649)

From PRG Wiki
Jump to: navigation, search
Afp.649
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74554691 (DT755374)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1189223 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XK16, mRNA sequence

DNA Sequence

ACTTGGTGGATTGATTGCACTGAATCTGTCAGGCAATGAGTTAAAGGCCTTACCTGATTCAATTCGGCGGACTAGAACGCCTGGAGGAGCTTTATCTTTCATCTAACCGTTTGGAATCACTGCCAGATTCCATTGGAAAGTTACTTAACCTGAAAATCCTGGATGTATCCTCCAACAAACTTAAGGCCTTTCCTGACAGTATCTCTCATTGCAGATCACTGGTGGAGCTGGACGCAGGCTACAATTCTCTAGCATACTTGCCAACTAACATTGGATATGAATTGGTCAATCTGATCAGGCTCTCTGTTCAATATAATAAGCTCCGTTCATTTCCAAGTTCCATCTGTGAGATGACGTCTTTACGCTATTTGGATGCACACTTTAATGAGCTTCATGGTCTTCCAAATTCTGTTGGGAGATTGACAAATCTAGAGGTCCTTAATCTCGGCAGTAATTTCAGTGACCTCAAAGAGCTTCCTGATACATTTGGTTATCTGATCAATCTTAAGGAACTTGATCTTAGCAACAACCAGATTCATGCTCTTCCAATTACATTTGGTCGGCTTGACAATCTAACCAAGCTTAACCTGGACCAGAACCCAATTGTCACTCCTCCTGTGGAGATTGTAAATAATGGGGTTGAAGCTGTTAAAGAGTTCATGGCAAAGAGGTGGCTCGATATTCTAGTTGAGGAAGAGGAGAAGAGCATGGCTGAAGAAAATAATGGGTGGTTGCAACGCAGCACTTCATTGCTGACAAGGAGCACGTCGATGTTGAAAAGCTATGCTTCTAATGTATCGGAGAGTGTTACTGAATATTTGGGGTGGAGGAGTTAAATCCCCAAGAGACCCATATCTCGATCAGCAGTTGTGAGCTTGCCATCAGTTTCTGATATCACGCGAGCACCGCTTTCTTACTTACATAGTATAATAGTTTGCTATTATAATTCAACTGCTTAAGTCAC


Protein sequences

Name Description Sequence
Afp.649 translated coding region predicted by ESTScan from UniGene Afp.649

XLGGLIALNLSGNELKALPDQFGGLERLEELYLSSNRLESLPDSIGKLLNLKILDVSSNKLKAFPDSISHCRSLVELDAGYNSLAYLPTNIGYELVNLIRLSVQYNKLRSFPSSICEMTSLRYLDAHFNELHGLPNSVGRLTNLEVLNLGSNFSDLKELPDTFGYLINLKELDLSNNQIHALPITFGRLDNLTKLNLDQNPIVTPPVEIVNNGVEAVKEFMAKRWLDILVEEEEKSMAEENNGWLQRSTSLLTRSTSMLKSYASNVSESVTEYLGWRS


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-205 L domain-like,LRR

XLGGLIALNLSGNELKALPDQFGGLERLEELYLSSNRLESLPDSIGKLLNLKILDVSSNKLKAFPDSISHCRSLVELDAGYNSLAYLPTNIGYELVNLIRLSVQYNKLRSFPSSICEMTSLRYLDAHFNELHGLPNSVGRLTNLEVLNLGSNFSDLKELPDTFGYLINLKELDLSNNQIHALPITFGRLDNLTKLNLDQNPIVTP

HMMSmart: SM00364
2-21 Leucine-rich repeats, bacterial type

LGGLIALNLSGNELKALPDQ

HMMSmart: SM00369
IPR003591
2-24 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGGLIALNLSGNELKALPDQFGG

Gene3D: G3DSA:3.80.10.10
4-77 no description

GLIALNLSGNELKALPDQFGGLERLEELYLSSNRLESLPDSIGKLLNLKILDVSSNKLKAFPDSISHCRSLVEL

HMMPanther: PTHR23155:SF34
4-273 LEUCINE-RICH REPEAT-CONTAINING PROTEIN,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GLIALNLSGNELKALPDQFGGLERLEELYLSSNRLESLPDSIGKLLNLKILDVSSNKLKAFPDSISHCRSLVELDAGYNSLAYLPTNIGYELVNLIRLSVQYNKLRSFPSSICEMTSLRYLDAHFNELHGLPNSVGRLTNLEVLNLGSNFSDLKELPDTFGYLINLKELDLSNNQIHALPITFGRLDNLTKLNLDQNPIVTPPVEIVNNGVEAVKEFMAKRWLDILVEEEEKSMAEENNGWLQRSTSLLTRSTSMLKSYASNVSESVTEY

HMMPanther: PTHR23155
4-273 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GLIALNLSGNELKALPDQFGGLERLEELYLSSNRLESLPDSIGKLLNLKILDVSSNKLKAFPDSISHCRSLVELDAGYNSLAYLPTNIGYELVNLIRLSVQYNKLRSFPSSICEMTSLRYLDAHFNELHGLPNSVGRLTNLEVLNLGSNFSDLKELPDTFGYLINLKELDLSNNQIHALPITFGRLDNLTKLNLDQNPIVTPPVEIVNNGVEAVKEFMAKRWLDILVEEEEKSMAEENNGWLQRSTSLLTRSTSMLKSYASNVSESVTEY

ProfileScan: PS51450
IPR001611
4-25 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLIALNLSGNELKALPDQFGGL

HMMPfam: PF00560
IPR001611
5-25 LRR_1
Leucine-rich repeat

LIALNLSGNELKALPDQFGGL

HMMSmart: SM00369
IPR003591
25-47 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LERLEELYLSSNRLESLPDSIGK

HMMSmart: SM00365
25-43 Leucine-rich repeat, SDS22-like subfamily

LERLEELYLSSNRLESLPD

HMMSmart: SM00364
25-44 Leucine-rich repeats, bacterial type

LERLEELYLSSNRLESLPDS

ProfileScan: PS51450
IPR001611
27-48 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLEELYLSSNRLESLPDSIGKL

HMMPfam: PF13855
27-84 LRR_8,Leucine rich repeat

RLEELYLSSNRLESLPDSIGKLLNLKILDVSSNKLKAFPDSISHCRSLVELDAGYNSL

HMMSmart: SM00365
48-70 Leucine-rich repeat, SDS22-like subfamily

LLNLKILDVSSNKLKAFPDSISH

HMMSmart: SM00364
48-67 Leucine-rich repeats, bacterial type

LLNLKILDVSSNKLKAFPDS

HMMSmart: SM00369
IPR003591
48-71 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLNLKILDVSSNKLKAFPDSISHC

ProfileScan: PS51450
IPR001611
50-71 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKILDVSSNKLKAFPDSISHC

FPrintScan: PR00019
51-64 LEURICHRPT,Leucine-rich repeat signature

LKILDVSSNKLKAF

HMMSmart: SM00364
71-90 Leucine-rich repeats, bacterial type

CRSLVELDAGYNSLAYLPTN

HMMSmart: SM00369
IPR003591
72-94 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

RSLVELDAGYNSLAYLPTNIGYE

ProfileScan: PS51450
IPR001611
73-94 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVELDAGYNSLAYLPTNIGYE

Gene3D: G3DSA:3.80.10.10
78-207 no description

DAGYNSLAYLPTNIGYELVNLIRLSVQYNKLRSFPSSICEMTSLRYLDAHFNELHGLPNSVGRLTNLEVLNLGSNFSDLKELPDTFGYLINLKELDLSNNQIHALPITFGRLDNLTKLNLDQNPIVTPPV

HMMSmart: SM00369
IPR003591
95-118 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVNLIRLSVQYNKLRSFPSSICEM

HMMSmart: SM00364
95-114 Leucine-rich repeats, bacterial type

LVNLIRLSVQYNKLRSFPSS

HMMSmart: SM00365
95-126 Leucine-rich repeat, SDS22-like subfamily

LVNLIRLSVQYNKLRSFPSSICEMTSLRYLDA

ProfileScan: PS51450
IPR001611
97-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLIRLSVQYNKLRSFPSSICEM

HMMPfam: PF13504
119-135 LRR_7,Leucine rich repeat

TSLRYLDAHFNELHGLP

ProfileScan: PS51450
IPR001611
120-141 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLDAHFNELHGLPNSVGRL

HMMSmart: SM00364
120-137 Leucine-rich repeats, bacterial type

SLRYLDAHFNELHGLPNS

HMMSmart: SM00369
IPR003591
141-165 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLEVLNLGSNFSDLKELPDTFGY

HMMSmart: SM00364
141-162 Leucine-rich repeats, bacterial type

LTNLEVLNLGSNFSDLKELPDT

HMMPfam: PF13855
142-202 LRR_8,Leucine rich repeat

TNLEVLNLGSNFSDLKELPDTFGYLINLKELDLSNNQIHALPITFGRLDNLTKLNLDQNPI

ProfileScan: PS51450
IPR001611
143-163 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLNLGSNFSDLKELPDTF

FPrintScan: PR00019
166-179 LEURICHRPT,Leucine-rich repeat signature

LINLKELDLSNNQI

HMMSmart: SM00364
166-185 Leucine-rich repeats, bacterial type

LINLKELDLSNNQIHALPIT

HMMSmart: SM00369
IPR003591
166-188 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLKELDLSNNQIHALPITFGR

HMMSmart: SM00365
166-194 Leucine-rich repeat, SDS22-like subfamily

LINLKELDLSNNQIHALPITFGRLDNLTK

ProfileScan: PS51450
IPR001611
168-189 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKELDLSNNQIHALPITFGRL

HMMSmart: SM00369
IPR003591
189-212 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LDNLTKLNLDQNPIVTPPVEIVNN

ProfileScan: PS51450
IPR001611
191-212 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTKLNLDQNPIVTPPVEIVNN

Seg: seg
231-240 seg

EEEEKSMAEE

Seg: seg
247-257 seg

RSTSLLTRSTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox