PRGDB00065582 (Afp.766)

From PRG Wiki
Jump to: navigation, search
Afp.766
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74542420 (DT747515)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1181364 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1W890, mRNA sequence

DNA Sequence

GTGAGAGGTGAGAGTGTGAGAATTCAACTTAACTTAACACAACTCATTGCCATTCTCTCAATGGCTGCTACTACTACCACTTTCAAAGCTTCATTGTTGTTCCTTACTCTTTTCTTTACACTTCTCTTTCACATCACTACTTCACTACAAGAAACAGAGATTTTAATCACTTTCAAGAGTTCCATTGAAGATCCAATGAACTCTCTCTCTTCTTGGTCTAATACTTCAAACACACATCTTTGTAACTGGACTGGTATTACTTGTTCTTCCTCCAAACTTTCTCCTTCAGTTACTTCTCTTAACCTTCAAGGTCTTAATCTTTCTGGTGAAGTTACTCCTTCATTATGTCAACTCCCTAACCTTTCTCATCTTAATCTTGCTGACAATTTCTTTAACCAACCAATCCCACTTCATCTTGCTCAATGCAACTTTCTACAAACTTTGAATCTAAGTTATAATCTCATTTGGGGTACTATTCCAGATCAAATATCTCTGTTTACTTCTTTGAAAGTACTTGATTTAAGTAAGAATCATATTGAAGGAGTAATTCCTGACAGCCTTGGGTCTCTTAAGAATCTTCAAGTTTTGAACTTGGGAAGCAACTTGTTTTCAGGTAGTGTTCCTTCTACTATTTTTGAGAATTTTACGCAACTTGTTGTTCTTGATTTATCTGAAAACCCATTTCTTATAAGTGAGATTCCTGAAGAAATTGGTAAACTTGAAAAACTTCAGCAATTGTCTTTACGAAGATCTAGTTTTCATGGTTTTATTCCTGAATCTCTTGTGGAGTTACTTGGATTGAAGTTTTAGACCTTTCTCAAAACAATTTAACTGGTGAGATTCCTTTGAAACTTGGTTTGAGTCTTGAGAATAATATTTATTTGATGTTTCA


Protein sequences

Name Description Sequence
Afp.766 translated coding region predicted by ESTScan from UniGene Afp.766

VRGESVRIQLNLTQLIAILSMAATTTTFKASLLFLTLFFTLLFHITTSLQETEILITFKSSIEDPMNSLSSWSNTSNTHLCNWTGITCSSSKLSPSVTSLNLQGLNLSGEVTPSLCQLPNLSHLNLADNFFNQPIPLHLAQCNFLQTLNLSYNLIWGTIPDQISLFTSLKVLDLSKNHIEGVIPDSLGSLKNLQVLNLGSNLFSGSVPSTIFENFTQLVVLDLSENPFLISEIPEEIGKLEKLQQLSLRRSSFHGFIPESLVELLGLKF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
13-264 FAMILY NOT NAMED,FAMILY NOT NAMED

TQLIAILSMAATTTTFKASLLFLTLFFTLLFHITTSLQETEILITFKSSIEDPMNSLSSWSNTSNTHLCNWTGITCSSSKLSPSVTSLNLQGLNLSGEVTPSLCQLPNLSHLNLADNFFNQPIPLHLAQCNFLQTLNLSYNLIWGTIPDQISLFTSLKVLDLSKNHIEGVIPDSLGSLKNLQVLNLGSNLFSGSVPSTIFENFTQLVVLDLSENPFLISEIPEEIGKLEKLQQLSLRRSSFHGFIPESLVEL

Seg: seg
24-49 seg

TTTTFKASLLFLTLFFTLLFHITTSL

superfamily: SSF52058
45-269 L domain-like,LRR

ITTSLQETEILITFKSSIEDPMNSLSSWSNTSNTHLCNWTGITCSSSKLSPSVTSLNLQGLNLSGEVTPSLCQLPNLSHLNLADNFFNQPIPLHLAQCNFLQTLNLSYNLIWGTIPDQISLFTSLKVLDLSKNHIEGVIPDSLGSLKNLQVLNLGSNLFSGSVPSTIFENFTQLVVLDLSENPFLISEIPEEIGKLEKLQQLSLRRSSFHGFIPESLVELLGLKF

HMMPfam: PF08263
IPR013210
50-89 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QETEILITFKSSIEDPMNSLSSWSNTSNTHLCNWTGITCS

Gene3D: G3DSA:3.80.10.10
50-267 no description

QETEILITFKSSIEDPMNSLSSWSNTSNTHLCNWTGITCSSSKLSPSVTSLNLQGLNLSGEVTPSLCQLPNLSHLNLADNFFNQPIPLHLAQCNFLQTLNLSYNLIWGTIPDQISLFTSLKVLDLSKNHIEGVIPDSLGSLKNLQVLNLGSNLFSGSVPSTIFENFTQLVVLDLSENPFLISEIPEEIGKLEKLQQLSLRRSSFHGFIPESLVELLGL

Seg: seg
67-78 seg

NSLSSWSNTSNT

Seg: seg
89-99 seg

SSSKLSPSVTS

HMMSmart: SM00369
IPR003591
118-142 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLSHLNLADNFFNQPIPLHLAQC

HMMPfam: PF13516
118-140 LRR_6,Leucine Rich repeat

LPNLSHLNLADNFFNQPIPLHLA

HMMPfam: PF13516
142-157 LRR_6,Leucine Rich repeat

CNFLQTLNLSYNLIWG

HMMSmart: SM00369
IPR003591
166-189 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FTSLKVLDLSKNHIEGVIPDSLGS

HMMPfam: PF13855
167-227 LRR_8,Leucine rich repeat

TSLKVLDLSKNHIEGVIPDSLGSLKNLQVLNLGSNLFSGSVPSTIFENFTQLVVLDLSENP

HMMSmart: SM00369
IPR003591
190-214 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLQVLNLGSNLFSGSVPSTIFEN

HMMSmart: SM00369
IPR003591
215-240 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FTQLVVLDLSENPFLISEIPEEIGKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox