PRGDB00065583 (Afp.928)

From PRG Wiki
Jump to: navigation, search
Afp.928
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71721429 (DR952066)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1143605 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1RY61, mRNA sequence

DNA Sequence

TATACTTTTATTTGAACTACAACAAATGGGCGTAACAATTGATGATGGTACTCACAGAAAGAATCAAAAGAATTTTTTTATCTATTACTTGAGTGCATTGGACCCCCGCAATTTTTTGGTTTCTTTGTCACCAATCCTATACCAACTCCACCATCCACATTCTTGTCATTTTCCTTCTTTAGGATCTCTCAACCAGATCTAATGGATTCAAGAACTTGAACAACCTCTGCCATGTTTGGTCTCCTCGAGGGAGCTTCAGAAGTACAGATGAGCCCCAACTTCATGACCTGAATCAACTCATTCTCTGCAGAACCCCGAAGGCTTCGATCAAAGCAATCTGAAGCTGTGCCATTCTCCAACAGCTCCCTAACAAAGTCACATAGAATCACCACCTCGGATGCAGCTGGGCTCTCCACTGGTTTTCTCCCTGTAACCAGCTCTAACAAAATTATACCAAAACTATATACATCACACTTGTCACTGAATCTCAAACTCTGGCAGGCCAACTCTGGTGCAACATACCCAACAGCAGTGTGGAACTTGGTTAAACCATAACTATCTGACATGGGCAGTAACTTGAACAATCCATAATCAGACAACTTTGTTTCGTAAACTTCATCCAAGAGTATGTTGGTAGATTTGATGTTTAGATGAAGAACTTGGGGTTTACAATCATGGTGAAGGTAGGCAAGCGCCCTTGCTGTTCCAAGAGCAATTTGAAATCTTCTAGACCAGTCGAGATCATTCCTTCCGCTACTGGTACTTGCACCAGTATAGATATGTCCGTGGAGATGTTGAAAGAGATTTCCGTTGGGAATGAATTCCGATAGAATTAGCTGCATTGTAGATGACCAATAGTAGCCTGGAAAGCAACCAGATTGGGATGTG


Protein sequences

Name Description Sequence
Afp.928 translated coding region predicted by ESTScan from UniGene Afp.928

XTSQSGCFPGYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVLESIRSGXEILKKENDKNVDGGVGIGLVTKKPKNCGGPMHSSNR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-237 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XTSQSGCFPGYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVLESIRSGXEIL

HMMPanther: PTHR24420:SF874
8-236 SUBFAMILY NOT NAMED

FPGYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVLESIRSGXEI

HMMPanther: PTHR24420
8-236 FAMILY NOT NAMED,FAMILY NOT NAMED

FPGYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVLESIRSGXEI

superfamily: SSF56112
IPR011009
10-235 Protein kinase-like (PK-like)
Protein kinase-like domain

GYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVLESIRSGXE

HMMSmart: SM00219
IPR020635
10-227 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVL

HMMSmart: SM00220
IPR002290
10-230 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GYYWSSTMQLILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVLESI

HMMPfam: PF00069
IPR017442
19-225 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LILSEFIPNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQ

Gene3D: G3DSA:1.10.510.10
26-227 no description

PNGNLFQHLHGHIYTGASTSSGRNDLDWSRRFQIALGTARALAYLHHDCKPQVLHLNIKSTNILLDEVYETKLSDYGLFKLLPMSDSYGLTKFHTAVGYVAPELACQSLRFSDKCDVYSFGIILLELVTGRKPVESPAASEVVILCDFVRELLENGTASDCFDRSLRGSAENELIQVMKLGLICTSEAPSRRPNMAEVVQVL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox