PRGDB00065584 (Afp.1050)

From PRG Wiki
Jump to: navigation, search
Afp.1050
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71715697 (DR946334)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1137873 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1QY37, mRNA sequence

DNA Sequence

TGGAAAAGTAGTTAATAAACCTAAGCTTTACAATAAATAGATAAAGGCGACGACAACAACAACAACTAATaaaaagaaaaaagaaaaaGTGAGATATGTTATCTTACTACTAAGAGGAGAAAATCTTAGACATTGTTGACGTCTACCAACTCCAAAGCAGGTATCAGAGACTGGGAGGCGGTGCTTGTGCTTGAACCATCACCACCATTTGTTATCTTGTCAGAAGCAGCAGTTTTTAGTCCCAACTGTTGCAGTTGATGAACAACGTGTGACATCCTTGGCCTCACAGATGGGACATGTTGGGTGCAAGCATATACAAGGTCCACCACCTTTTGTATGACCCCAAGTTCAGGAGTATCAGAGATGAGTGGATCTAACAGATCCAAGTATCGGTGAGACTGTACCAATGGTGTGGCCCATTCAAAGATACTCTGCCAACCCACAGAATCAACCGACTGGCTAGGTCTGCACCCGCTGATGATTTCAAGTAGCAATACACCAAAGCTATAAACATCACTTTTTGTCGTAAGTTCATTTCTGTACACAAATTCTGGAGCAAGGTAGCCATATGTAGCAGCCATAACTGTTCTTTCGTGCATCACCTCCCACGGCACAAACTTTGAGAGGCCCACTCCCATAAGATGCGCACCGAACTCTTCGTCAAGCAAAACATTGCTGGCACGGATGTCCCTGTGCACAACATGTGGCTTCACCTTGTCGTGCAGGAACGCAATTCCTTGAGCAAGAGTGGTGGCAACTCTCATCCTCATCGACCAGTTCAAGCTTCTACCTCCCCTGGGTACGTGGTGTAGCCATCTATCCAAGGGACCATTGGCAACAAACTCATAAACAATATAACGATCACCATGATCATAGCAACACCCTTT


Protein sequences

Name Description Sequence
Afp.1050 translated coding region predicted by ESTScan from UniGene Afp.1050

KGCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQLQQLGLKTAASDKITNGGDGSSTSTASQSLIPALELVDVNNV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF213
1-215 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KGCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQLQQL

HMMPanther: PTHR24420
1-215 FAMILY NOT NAMED,FAMILY NOT NAMED

KGCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQLQQL

ProfileScan: PS50011
IPR000719
1-213 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KGCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQLQ

HMMSmart: SM00220
IPR002290
1-215 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KGCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQLQQL

HMMSmart: SM00219
IPR020635
1-212 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KGCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQL

Gene3D: G3DSA:1.10.510.10
2-210 no description

GCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVH

superfamily: SSF56112
IPR011009
2-220 Protein kinase-like (PK-like)
Protein kinase-like domain

GCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQLQQLGLKTA

HMMPfam: PF07714
IPR001245
2-212 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

GCCYDHGDRYIVYEFVANGPLDRWLHHVPRGGRSLNWSMRMRVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMHERTVMAATYGYLAPEFVYRNELTTKSDVYSFGVLLLEIISGCRPSQSVDSVGWQSIFEWATPLVQSHRYLDLLDPLISDTPELGVIQKVVDLVYACTQHVPSVRPRMSHVVHQL

PatternScan: PS00109
IPR008266
63-75 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

VVHRDIRASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox