PRGDB00065585 (Afp.1087)

From PRG Wiki
Jump to: navigation, search
Afp.1087
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71722001 (DR952638)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1144177 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1S229, mRNA sequence

DNA Sequence

GTTAGAGAACGTGGATGATGAGAGTGTGAAAATGCATGATGTGATTAGAGAATTAGCTTTATGGATCACTGGGAGAGATGAAGGTAAGGTTATTGTGAAGTCAGGTTACAACTTGAAAGAATTCCCCATAATTGATTTACATCCGACAGTGGTGGAAACAATATCCTTGATGAATACTGGAATCACTCATCTTGAAAAATTACCAAGCTGCCGAAACCTTTCAAACTTCTTTGCTCCCTATAATAATGATTTAAACCATATAAATGACGACTTTTTCCTTTCTATGCCCAATCTTAAGTTCTTAGATCTATCATCCAGTAAAATCACAAAACTACCCACAAGCATTCGTGAATTGTCTGAGTTGAAAGTCCTTAATTTGCTTGGAAGAGAGGGTTCAATTCCACGGGGAATGATAATGAATTTTTCGAATTTGGAGTTCTTGGAGTTGGATGTTTTAAAATCTGATGATTCTTCAGAGGAATTTTTCGAATTTGAAGAATTCAGATGCTTGAAAAAATTGAAATATCTGGGAATCTTTATTTCAGATTTCAAAGATCTTGAGAGGTTACTAAGCAACCCCCACTTGTGTAATTGTCTAAGGACTTTGGGTATTAAAAATTGCAAAGAGATTACCTTACCCACACTTTCATCATCGTATTTATCTCTTGGACGTCTTCAAAAACTGCAAGTTCTTCAAATTCTTAACTGTTCAGAGATCAAAGAGTGGATATTTGATTGCATCACAAATGATGATGAGCCAGAGATTGGGTTATTTGAAAGCTTGGAGACAATGGTCCTCGTCGATCTCCCCGAATTAATTATCTCATGGGATGCAAGGAATCTCCATTGTACACATTTCAGAAAACTCCATTACTAATATCTTTCATTGGTGTCACGCAATGGTGAATCTTACAT


Protein sequences

Name Description Sequence
Afp.1087 translated coding region predicted by ESTScan from UniGene Afp.1087

XLENVDDESVKMHDVIRELALWITGRDEGKVIVKSGYNLKEFPIIDLHPTVVETISLMNTGITHLEKLPSCRNLSNFFAPYNNDLNHINDDFFLSMPNLKFLDLSSSKITKLPTSIRELSELKVLNLLGREGSIPRGMIMNFSNLEFLELDVLKSDDSSEEFFEFEEFRCLKKLKYLGIFISDFKDLERLLSNPHLCNCLRTLGIKNCKEITLPTLSSSYLSLGRLQKLQVLQILNCSEIKEWIFDCITNDDEPEIGLFESLETMVLVDLPELIISWDARNLHCTHFRKLHY


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
11-292 L domain-like,LRR

KMHDVIRELALWITGRDEGKVIVKSGYNLKEFPIIDLHPTVVETISLMNTGITHLEKLPSCRNLSNFFAPYNNDLNHINDDFFLSMPNLKFLDLSSSKITKLPTSIRELSELKVLNLLGREGSIPRGMIMNFSNLEFLELDVLKSDDSSEEFFEFEEFRCLKKLKYLGIFISDFKDLERLLSNPHLCNCLRTLGIKNCKEITLPTLSSSYLSLGRLQKLQVLQILNCSEIKEWIFDCITNDDEPEIGLFESLETMVLVDLPELIISWDARNLHCTHFRKLHY

Gene3D: G3DSA:3.80.10.10
52-249 no description

VETISLMNTGITHLEKLPSCRNLSNFFAPYNNDLNHINDDFFLSMPNLKFLDLSSSKITKLPTSIRELSELKVLNLLGREGSIPRGMIMNFSNLEFLELDVLKSDDSSEEFFEFEEFRCLKKLKYLGIFISDFKDLERLLSNPHLCNCLRTLGIKNCKEITLPTLSSSYLSLGRLQKLQVLQILNCSEIKEWIFDCIT

HMMPfam: PF13855
97-150 LRR_8,Leucine rich repeat

PNLKFLDLSSSKITKLPTSIRELSELKVLNLLGREGSIPRGMIMNFSNLEFLEL

ProfileScan: PS51450
IPR001611
98-119 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKFLDLSSSKITKLPTSIREL

Seg: seg
160-168 seg

EEFFEFEEF

Seg: seg
212-223 seg

TLPTLSSSYLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox