PRGDB00065586 (Afp.1118)

From PRG Wiki
Jump to: navigation, search
Afp.1118
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74563333 (DT760524)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1194373 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YF15, mRNA sequence

DNA Sequence

AGACAAGAAAAAGCTTCCAAGGCTGCAGGAATTGCGGAAGATGGGATTGTTGATCCGCCGATGATCATAGCAGGCAATGTTTTTGTTGAGAATCTCAAGCAAGCAATAGATTTTGATGCGGTTGTCAAAGCAAGTCTGAAGGATTCCAACAAGCTCAATGGTGGAACTTTTAGCACTATTTACAAGGCAGTCATGCCCTCTGGGCTGATTTTGTCTGTAAAGAGGCTGAAATCGATGGACCGAGCAATAGTTCACTACCAAAACAAGATGATACGAGAGCTCGAAAGACTGGGAAGGCTCTGCCATGATAATCTGATGACACCCATTGGCTTTGTGATTTATGATGATGTTGCTCTCTTGTTGCATCCTTACCGAATGGAACCTTAGCTGAGCTTCTACATGACTCAATCGCCAAACCTGAATTTAAACCTGACTGGTCAACAAGACTTTCCATTGCCATAGGAGTAGCAGAGGGACTAGCTTTCCTTCATCACGTGGCCATTATTCACCTTGATATCTCTTCAGGAAACGTGTTCTTAGATGCTACTTACAAGCCTTTAGTTGGGGAAATTGAGATATCGAAGCTCTTAGATCCATCAAGGGGCACTGCGAGTATCAGTGCAGTGGCAGGCTCATTTGGTTATATACCTCCAGAATACGCATACACAATGCAAATGACAGCGCCAGGGAATGTTTATAGCTATGGAGTTGTGCTGTTGGAGATCCTCACAACTCGACTACCAGTTGACGAAGACTTTGGTGAAGGGATAGATCTGGTGAAATGGGTTCATAATGCACCAGCAAGGGGAGAAACCCCGAGCAATTCTTGATGCAGACTGAGCACAGTTTCATTTGCATGGAGGAACAGATGCTTGCGGTTCTAAAGGTGCATTGCTTTGTACTGAACTAC


Protein sequences

Name Description Sequence
Afp.1118 translated coding region predicted by ESTScan from UniGene Afp.1118

RQEKASKAAGIAEDGIVDPPMIIAGNVFVENLKQAIDFDAVVKASLKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGEGIDLVKWVHNAPAKGRNPEQFLMQTEHSFICMEEQMLAVLKVHCFVLNY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF671
12-297 SUBFAMILY NOT NAMED

AEDGIVDPPMIIAGNVFVENLKQAIDFDAVVKASLKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGEGIDLVKWVHNAPAKGRNPEQFLMQTEHSFICMEEQMLAVLKV

HMMPanther: PTHR24420
12-297 FAMILY NOT NAMED,FAMILY NOT NAMED

AEDGIVDPPMIIAGNVFVENLKQAIDFDAVVKASLKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGEGIDLVKWVHNAPAKGRNPEQFLMQTEHSFICMEEQMLAVLKV

superfamily: SSF56112
IPR011009
18-252 Protein kinase-like (PK-like)
Protein kinase-like domain

DPPMIIAGNVFVENLKQAIDFDAVVKASLKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDED

Gene3D: G3DSA:3.30.200.20
43-120 no description

KASLKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALL

ProfileScan: PS50011
IPR000719
46-304 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGEGIDLVKWVHNAPAKGRNPEQFLMQTEHSFICMEEQMLAVLKVHCFVLNY

HMMSmart: SM00220
IPR002290
46-285 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGEGIDLVKWVHNAPAKGRNPEQFLMQTEHSFI

HMMSmart: SM00219
IPR020635
46-300 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKDSNKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGEGIDLVKWVHNAPAKGRNPEQFLMQTEHSFICMEEQMLAVLKVHCF

HMMPfam: PF00069
IPR017442
50-252 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NKLNGGTFSTIYKAVMPSGLILSVKRLKSMDRAIVHYQNKMIRELERLGRLCHDNLMTPIGFVIYDDVALLLHPYXNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDED

Gene3D: G3DSA:1.10.510.10
125-255 no description

XNGTLAELLHDSIAKPEFKPDWSTRLSIAIGVAEGLAFLHHVAIIHLDISSGNVFLDATYKPLVGEIEISKLLDPSRGTASISAVAGSFGYIPPEYAYTMQMTAPGNVYSYGVVLLEILTTRLPVDEDFGE

PatternScan: PS00109
IPR008266
168-180 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IIHLDISSGNVFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox