PRGDB00065588 (Afp.1236)

From PRG Wiki
Jump to: navigation, search
Afp.1236
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71710865 (DR941502)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1133041 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Q543, mRNA sequence

DNA Sequence

CTCAAACTCTCTTCCAATCAATTCATAGGGCCTCTTCCTCAAGACCTCTTCAAGAGCTCCAACCTCTTGTTGCTTTCTGTCAACAACAATTCACTCAATGGTACCCTCCCTTCTGCAATTGGAGATCTTGCCTCCCTCAATGTCCTGAACCTAGGCAGAAACAGATTCACTGGACCTATCCCTCCGACGATTGGGAAGTTGAGCAAGCTATATGAGCTTCATCTTTCACACAACAGCTTCAACGGTGAAATCCCCTTCGAGCTTGGACAACTCCAGAATCTGCAGAGTACGTTGGACCTTAGCTACAACAATCTCACAGGCAAAATCCCACCTCTTGGGATGCTGTCCAAACTTGAAGTACTTGATCTATCTCACAATGAGCTCACTGGAGAAGTACCTTCGCAAGTTGGTGAGATGAGCAGCTTGAGCAAGCTTGATCTCTCTTACAACAATCTTCAAGGCCAACTTGATAAACAACTCTCGCAGTGGCCACCCAACACCTTTGCAGGGAACTCTAGACTTTGTGGAGGTCCTCTTCGTGCATGTGCAAAATCAGAGTCTGATGATATCCATGATAATAAAAAAGCATCTTCAACAGTAGTGATTATGGCCACTTCAACTGTAGCAGCCATTGTTCTATTACTGATTGGGCTTGTACTACTCAACCGGAGACACCAATCCCTGAGAAGAGCCAGTGAAGTGAACTGTGGATATTCATCTAGTTCTTCTCAAACACATCGGCGTTTACTATTCCAAGGTGGTGCCACAAGGAAAGAATTTAAATGGGAAGATATCATGGAAGCAACCAACACCTGAGCGACATTATGTGATTGGGTCACGGGGGTCTGGGATGGTTTATATGCAGAGCTACCACTGGAGAGACAGTTGCAGTCAGAGATACTAAGAA


Protein sequences

Name Description Sequence
Afp.1236 translated coding region predicted by ESTScan from UniGene Afp.1236

LKLSSNQFIGPLPQDLFKSSNLLLLSVNNNSLNGTLPSAIGDLASLNVLNLGRNRFTGPIPPTIGKLSKLYELHLSHNSFNGEIPFELGQLQNLQSTLDLSYNNLTGKIPPLGMLSKLEVLDLSHNELTGEVPSQVGEMSSLSKLDLSYNNLQGQLDKQLSQWPPNTFAGNSRLCGGPLRACAKSESDDIHDNKKASSTVVIMATSTVAAIVLLLIGLVLLNRRHQSLRRASEVNCGYSSSSSQTHRRLLFQGGATRKEFKWEDIMEATNTXATLCDWVTGVWDGLYAELPLERQLQSEILRX


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-183 L domain-like,LRR

LKLSSNQFIGPLPQDLFKSSNLLLLSVNNNSLNGTLPSAIGDLASLNVLNLGRNRFTGPIPPTIGKLSKLYELHLSHNSFNGEIPFELGQLQNLQSTLDLSYNNLTGKIPPLGMLSKLEVLDLSHNELTGEVPSQVGEMSSLSKLDLSYNNLQGQLDKQLSQWPPNTFAGNSRLCGGPLRACA

HMMPanther: PTHR24420:SF864
1-269 SUBFAMILY NOT NAMED

LKLSSNQFIGPLPQDLFKSSNLLLLSVNNNSLNGTLPSAIGDLASLNVLNLGRNRFTGPIPPTIGKLSKLYELHLSHNSFNGEIPFELGQLQNLQSTLDLSYNNLTGKIPPLGMLSKLEVLDLSHNELTGEVPSQVGEMSSLSKLDLSYNNLQGQLDKQLSQWPPNTFAGNSRLCGGPLRACAKSESDDIHDNKKASSTVVIMATSTVAAIVLLLIGLVLLNRRHQSLRRASEVNCGYSSSSSQTHRRLLFQGGATRKEFKWEDIMEAT

HMMPanther: PTHR24420
1-269 FAMILY NOT NAMED,FAMILY NOT NAMED

LKLSSNQFIGPLPQDLFKSSNLLLLSVNNNSLNGTLPSAIGDLASLNVLNLGRNRFTGPIPPTIGKLSKLYELHLSHNSFNGEIPFELGQLQNLQSTLDLSYNNLTGKIPPLGMLSKLEVLDLSHNELTGEVPSQVGEMSSLSKLDLSYNNLQGQLDKQLSQWPPNTFAGNSRLCGGPLRACAKSESDDIHDNKKASSTVVIMATSTVAAIVLLLIGLVLLNRRHQSLRRASEVNCGYSSSSSQTHRRLLFQGGATRKEFKWEDIMEAT

Gene3D: G3DSA:3.80.10.10
1-163 no description

LKLSSNQFIGPLPQDLFKSSNLLLLSVNNNSLNGTLPSAIGDLASLNVLNLGRNRFTGPIPPTIGKLSKLYELHLSHNSFNGEIPFELGQLQNLQSTLDLSYNNLTGKIPPLGMLSKLEVLDLSHNELTGEVPSQVGEMSSLSKLDLSYNNLQGQLDKQLSQW

Seg: seg
19-33 seg

SSNLLLLSVNNNSLN

HMMSmart: SM00369
IPR003591
43-66 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LASLNVLNLGRNRFTGPIPPTIGK

ProfileScan: PS51450
IPR001611
45-67 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNVLNLGRNRFTGPIPPTIGKL

HMMPfam: PF12799
45-80 LRR_4,Leucine Rich repeats (2 copies)

SLNVLNLGRNRFTGPIPPTIGKLSKLYELHLSHNSF

HMMSmart: SM00369
IPR003591
67-91 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSKLYELHLSHNSFNGEIPFELGQL

ProfileScan: PS51450
IPR001611
69-92 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYELHLSHNSFNGEIPFELGQLQ

ProfileScan: PS51450
IPR001611
93-116 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSTLDLSYNNLTGKIPPLGMLS

HMMPfam: PF13855
97-152 LRR_8,Leucine rich repeat

TLDLSYNNLTGKIPPLGMLSKLEVLDLSHNELTGEVPSQVGEMSSLSKLDLSYNNL

HMMSmart: SM00369
IPR003591
115-137 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSKLEVLDLSHNELTGEVPSQVG

ProfileScan: PS51450
IPR001611
117-139 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLDLSHNELTGEVPSQVGEM

FPrintScan: PR00019
118-131 LEURICHRPT,Leucine-rich repeat signature

LEVLDLSHNELTGE

FPrintScan: PR00019
139-152 LEURICHRPT,Leucine-rich repeat signature

MSSLSKLDLSYNNL

HMMSmart: SM00369
IPR003591
139-170 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MSSLSKLDLSYNNLQGQLDKQLSQWPPNTFAG

ProfileScan: PS51450
IPR001611
141-162 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSKLDLSYNNLQGQLDKQLSQ

Seg: seg
208-221 seg

VAAIVLLLIGLVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox