PRGDB00065589 (Afp.1253)

From PRG Wiki
Jump to: navigation, search
Afp.1253
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71718127 (DR948764)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1140303 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1RD20, mRNA sequence

DNA Sequence

ATTTTAAACCAGACAACTAAGAAATCCATTATTCGAGCAGAGAAATCCGCCAAACTTTATGTGAATATAGAAGATATCTTTTCAACCAAACTTAATATCATTAACCTTAATTGTTTCGGTTCCATTATCGAAAAATCTCCCCAAGGCAAGTTTTGCCGTATCCGAGATAAGAAGCTGATAACCCTGTTTTGTGTATCTGTTTCTGGGCAAGATTTTAGCGCCTTAGAAATGGAGAAGGATGGAGTAGGCGAGTCCTCTCCTAGAGGAGTACTAGATAACTGCTCGAGGAGCTTAGAATCCGAAACGAGTTCTTCTAAGGCTAGTACCTCTGATTCTGAATCTCCACCTACTAAAAATGCTTCACACTGGCGTAGTTTCTTGTCTATGTTGAAAAGTAGATCAATTAGGCGCTTAGCCAGCTTTCCTCCTGTTAGCGCTCCAAAGTTATCAAAAAGAATTAGTAGAAGCATGAGAGAGAATCCAGCCCCATCATTAATTCCAGCTGAATATACCAATATGTATAGTTTCAAGTCTTCGTGGAGAAACTTCACGTTTGCTGAACTCCAAGCTGCAACCAAAAACTTCAGCTCTGAAAATTTGATTGGAAAAGGTGGTTTTGCGGAAGTTTACAAAGGTTGTTTGCAAGATGGCCAACATGTAGCAATTAAGCGACTGACACGTGGGACGTCAGATGAGAGAACTGGAGACTTCCTAACTGAGCTTGGAATTATAGTCCATGTTAACCATCATAATACTGCAAAGTTGATAGGGTACGGGATCGAAGGAGGAATGCACCTGGTTCTTGAATTGTCTCCCCATGGATGCTTAGCCTCTCTACTCTATGGTTCAAAGGAGAAACTGGACTGGGGTATCAGATACAAAATTGCTTTGGGGATAGCTG


Protein sequences

Name Description Sequence
Afp.1253 translated coding region predicted by ESTScan from UniGene Afp.1253

ILNQTTKKSIIRAEKSAKLYVNIEDIFSTKLNIINLNCFGSIIEKSPQGKFCRIRDKKLITLFCVSVSGQDFSALEMEKDGVGESSPRGVLDNCSRSLESETSSSKASTSDSESPPTKNASHWRSFLSMLKSRSIRRLASFPPVSAPKLSKRISRSMRENPAPSLIPAEYTNMYSFKSSWRNFTFAELQAATKNFSSENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLELSPHGCLASLLYGSKEKLDWGIRYKIALGIAX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF794
67-300 SUBFAMILY NOT NAMED

VSGQDFSALEMEKDGVGESSPRGVLDNCSRSLESETSSSKASTSDSESPPTKNASHWRSFLSMLKSRSIRRLASFPPVSAPKLSKRISRSMRENPAPSLIPAEYTNMYSFKSSWRNFTFAELQAATKNFSSENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLELSPHGCLASLLYGSKEKLDWGIRYKIALGIA

HMMPanther: PTHR24420
67-300 FAMILY NOT NAMED,FAMILY NOT NAMED

VSGQDFSALEMEKDGVGESSPRGVLDNCSRSLESETSSSKASTSDSESPPTKNASHWRSFLSMLKSRSIRRLASFPPVSAPKLSKRISRSMRENPAPSLIPAEYTNMYSFKSSWRNFTFAELQAATKNFSSENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLELSPHGCLASLLYGSKEKLDWGIRYKIALGIA

Seg: seg
95-114 seg

SRSLESETSSSKASTSDSES

superfamily: SSF56112
IPR011009
167-300 Protein kinase-like (PK-like)
Protein kinase-like domain

PAEYTNMYSFKSSWRNFTFAELQAATKNFSSENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLELSPHGCLASLLYGSKEKLDWGIRYKIALGIA

Gene3D: G3DSA:3.30.200.20
176-270 no description

FKSSWRNFTFAELQAATKNFSSENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLEL

ProfileScan: PS50011
IPR000719
195-301 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLELSPHGCLASLLYGSKEKLDWGIRYKIALGIAX

HMMPfam: PF07714
IPR001245
198-300 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENLIGKGGFAEVYKGCLQDGQHVAIKRLTRGTSDERTGDFLTELGIIVHVNHHNTAKLIGYGIEGGMHLVLELSPHGCLASLLYGSKEKLDWGIRYKIALGIA

PatternScan: PS00107
IPR017441
201-223 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGFAEVYKGCLQDGQHVAIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox