PRGDB00065590 (Afp.1302)

From PRG Wiki
Jump to: navigation, search
Afp.1302
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74530868 (DT740214)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1174063 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1US57, mRNA sequence

DNA Sequence

GCTAAAATGTAGTAATGTACTGTCGGAAAAAGGAACATATGATGCAAACATTGAAAAACATCCTTCGAATTTATATATGAAAAGGGATCACAAATTGAAACCCGGTGAAGATGAATCCGGTAGGACAACAGTCACAGGAGGAAAAGTGAACTCACAAATCctgaaaagaactaatgaaacaaaacctaaaaagtgggaaagaaaaaTCAATTTTGCATCAAGGAAACATCACTGTTCTTCCTGGTAAATAAGaaaaaaaaaCACAACCGGATTCCTGTTCGCCGGAAACTCATTAATTTATCCCTTTTCATCTTGCTGCTCCTATAACTTAGCATTTTAAAATTCATCCCAACTCTTCCTGACCTTCTGAAGGACATCTGATTAGCTCCAATATATTGACTACCTCTCCCATGTCTGGCCGGTTTGATGGAACTTGTGAAGTACAGATTAATCCCAATTTCATCACAGGAATTGCTTCCTCTGCTGGAAAGTTACCAAGGAGCCTTGAATCCACACACTCTTCCACCCTCCCTTCTTCTAAAGCCCCTCTTACCATGTCGCAAAGCACCACGACATCATCCTCCATATACTCCACAGGCCGCTTTCCTGTCACAATTTCTAGAACCAAGACACCAAATCCATACACATCACATTTTTCTGTTATTTTCACAGTTCGGCAAGCAAATTCAGGAGCCATGTAGCCGAGTGCGCTTTGAACCTTGCTGCTGAGAACGTAACGGTCTAGCATAGGCAATAGTCTTGCAAGGCCGAAATCCCCAACCTTTGGCTCACCAGAATCATCAATCAAGACATTGCTTGATTTCAGATTGTAGTGTATTACATTCATTTGGTGCAAGTGTGCCAGACTTTTGGCTGTTCCAAGAATTATGTTGAACCTATCATGCCAGGAAAGAATGTTTTCACTTGGTCCTTCATGAAGATGTTTGTACAAACTCC


Protein sequences

Name Description Sequence
Afp.1302 translated coding region predicted by ESTScan from UniGene Afp.1302

XSLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEELG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-193 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XSLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELI

HMMSmart: SM00219
IPR020635
1-190 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XSLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNIL

Gene3D: G3DSA:1.10.510.10
2-191 no description

SLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILE

superfamily: SSF56112
IPR011009
2-198 Protein kinase-like (PK-like)
Protein kinase-like domain

SLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSE

HMMPanther: PTHR24420:SF869
2-202 SUBFAMILY NOT NAMED

SLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEE

HMMPanther: PTHR24420
2-202 FAMILY NOT NAMED,FAMILY NOT NAMED

SLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEE

HMMSmart: SM00220
IPR002290
2-193 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

SLYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELI

HMMPfam: PF00069
IPR017442
3-186 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LYKHLHEGPSENILSWHDRFNIILGTAKSLAHLHQMNVIHYNLKSSNVLIDDSGEPKVGDFGLARLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDSRLLGNFPAEEAIPVMKLGLICTSQVPSNRPDMGEV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox