PRGDB00065592 (Afp.1499)

From PRG Wiki
Jump to: navigation, search
Afp.1499
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71707839 (DR938476)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1130015 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1PN61, mRNA sequence

DNA Sequence

CCTCAGCTTTGTGGGGTTCCTCTTGGAAAATGCAATGCTGGTACAAAGTCTGGTTTAAGTTCTAGAACCATTGCAGCTATTGTGATTGTGTTGATGTCTGGTTCAGTGGTTTTGGCTTCAGTGTTAATTGGGTATGTacaagggaagaaaagaaagaagaacaggaatggaaatcaaaatgatatagaagaaggagaagaagaagagaaTGATAATGGGGATTCAGGTGAGGGGAAACTTATATTGTTTCAAGGTGCTGAACATTTGACATTGGAGGATGTGTTGAATGCTACAGGTCAAGTCATGGAGAAAACAAGTTATGGTACTGTTTATAAGGCGAAGCTCGCAGACGGAGGAACCATCGCTTTGAGATTGTTAAGAGAAGGCACTTGCAAAGATAGAGGTTCTTGCTTGCCTGTAATACGGCAGCTTGGACGTGTTCGTCACGAAAATCTTGTTTCTCTTAGAGCTTTCTATCAGGGACAGAGAGGGGAAAAGCTCCTCATTTATGATTATTTCTCCCACAAAAATCTTTATGAGCTTCTTCATGATACCAGAGCAGGGAAGCCAATGCTGAACTGGGCTCGTAGACATAAGATTGCATTGGGTATAGCTAGAGGATTAGCACACCTGCATACAGGTGTCGAAGTGCCAATTACCCATGGGAATGTAAAATCAAAGAACATCATTGTGGATGAATTCTTCATGGCTAGGGTTACCGAGTTTGGACTTGACAAGTTAATGGTACAAGCAGTGACCGATGAGATGGTGGCAATTGCAAAAACAGATGGGTACAACGCTCCAGAACTGCAGAAGATGAAGAAATGCAGTTCAAGGACTGATGTGTATGCTTTTGGTATACTA


Protein sequences

Name Description Sequence
Afp.1499 translated coding region predicted by ESTScan from UniGene Afp.1499

PQLCGVPLGKCNAGTKSGLSSRTIAAIVIVLMSGSVVLASVLIGYVQGKKRKKNRNGNQNDIEEGEEEENDNGDSGEGKLILFQGAEHLTLEDVLNATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF839
17-288 TMKL1 (TRANSMEMBRANE KINASE-LIKE 1); ATP BINDING / KINASE/ PROTEIN SERINE/THREO

SGLSSRTIAAIVIVLMSGSVVLASVLIGYVQGKKRKKNRNGNQNDIEEGEEEENDNGDSGEGKLILFQGAEHLTLEDVLNATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

HMMPanther: PTHR24420
17-288 FAMILY NOT NAMED,FAMILY NOT NAMED

SGLSSRTIAAIVIVLMSGSVVLASVLIGYVQGKKRKKNRNGNQNDIEEGEEEENDNGDSGEGKLILFQGAEHLTLEDVLNATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

Seg: seg
47-78 seg

QGKKRKKNRNGNQNDIEEGEEEENDNGDSGEG

superfamily: SSF56112
IPR011009
73-288 Protein kinase-like (PK-like)
Protein kinase-like domain

GDSGEGKLILFQGAEHLTLEDVLNATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

HMMSmart: SM00219
IPR020635
89-288 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LTLEDVLNATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

ProfileScan: PS50011
IPR000719
96-288 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

HMMSmart: SM00220
IPR002290
96-288 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NATGQVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

HMMPfam: PF07714
IPR001245
100-288 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

QVMEKTSYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAFYQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL

Gene3D: G3DSA:3.30.200.20
106-158 no description

SYGTVYKAKLADGGTIALRLLREGTCKDRGSCLPVIRQLGRVRHENLVSLRAF

Gene3D: G3DSA:1.10.510.10
159-288 no description

YQGQRGEKLLIYDYFSHKNLYELLHDTRAGKPMLNWARRHKIALGIARGLAHLHTGVEVPITHGNVKSKNIIVDEFFMARVTEFGLDKLMVQAVTDEMVAIAKTDGYNAPELQKMKKCSSRTDVYAFGIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox