PRGDB00065593 (Afp.1541)

From PRG Wiki
Jump to: navigation, search
Afp.1541
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71707379 (DR938016)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1129555 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1PK81, mRNA sequence

DNA Sequence

TCCGCCATTGTGTTCAATCTGTCAGCACAAGGCACCTGTATTTGGGAAGCCTCCAAGGTGGTTTAGTTATGCTGAGCTTGAACTTGCTACAGGTGGATTTTCACAAGCAAATTTCTTGGCCGAAGGTGGGTTTGGCTCTGTCCACAGGGGAGTCTTACCAGATGGCCAGGCAGTTGCTGTCAAGCAGCATAAACTGGCTAGTTCTCAGGGTGATCTTGAATTCTGCTCAGAAGTTGAGGTTCTTAGCTGTGCACAGCACAGAAATGTTGTGATGCTGATAGGATTCTGCGTTGAGGACAAAAGAAGGTTGTTGGTCTATGAATATATATGCAACGGGTCGTTGGATTCTCATCTTTATGGGCGTAACCGACAACCATTAGAATGGGCTGCACGGCAAAAAGTTGCAGTTGGAGCTGCGCGAGGATTGAGATACCTTCACGAAGAATGTAGAGTAGGCTGCATTGTCCACCGCGATATGCGCCCCAACAATATCCTCATCACCCATGATTTTGAACCACTGGTTGGAGACTTTGGACTGGCAAGGTGGCAGCCAGATGGAGACATGGGTGTGGATACAAGAGTCATTGGAACATTCGGGTATTTGGCGCCAGAATATGCTCAAAGTGGCCAGATCACTGAAAAAGCTGATGTGTATTCATTTGGTGTGGTATTGGTAGAGCTTGTTACAGGACGAAAAGCTGTTGACATTACCAGGCCTAAGGTCAGCAGTGTCTTACTGAATGGGCGCGCCCACTACTAGAAGAATATGCCATTGATGAACTGATAGACCCATCCTTAGAAAACAGTTATGCAGAAAATGAAGTTTATTGTA


Protein sequences

Name Description Sequence
Afp.1541 translated coding region predicted by ESTScan from UniGene Afp.1541

XPPLCSICQHKAPVFGKPPRWFSYAELELATGGFSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSYAENEVYCX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF821
2-278 SUBFAMILY NOT NAMED

PPLCSICQHKAPVFGKPPRWFSYAELELATGGFSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSYAENEVYC

HMMPanther: PTHR24420
2-278 FAMILY NOT NAMED,FAMILY NOT NAMED

PPLCSICQHKAPVFGKPPRWFSYAELELATGGFSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSYAENEVYC

Gene3D: G3DSA:3.30.200.20
17-96 no description

KPPRWFSYAELELATGGFSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGF

superfamily: SSF56112
IPR011009
20-271 Protein kinase-like (PK-like)
Protein kinase-like domain

RWFSYAELELATGGFSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSY

ProfileScan: PS50011
IPR000719
34-279 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSYAENEVYCX

HMMSmart: SM00220
IPR002290
34-272 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSYA

HMMSmart: SM00219
IPR020635
34-271 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSQANFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEWARPLLEEYAIDELIDPSLENSY

HMMPfam: PF07714
IPR001245
38-249 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NFLAEGGFGSVHRGVLPDGQAVAVKQHKLASSQGDLEFCSEVEVLSCAQHRNVVMLIGFCVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDITRPKVSSXLTEW

Gene3D: G3DSA:1.10.510.10
97-235 no description

CVEDKRRLLVYEYICNGSLDSHLYGRNRQPLEWAARQKVAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAV

PatternScan: PS00109
IPR008266
155-167 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDMRPNNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox