PRGDB00065594 (Afp.1553)

From PRG Wiki
Jump to: navigation, search
Afp.1553
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71714267 (DR944904)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1136443 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1QP60, mRNA sequence

DNA Sequence

GTGGTTCTTCATTAAAGCTTTCACATAACTAATTCAAATACACGAGAAACCTGTAAGTTTTCTTCACGGAAAAGTTGAAAAACACAGCTCATTTCTTCATCTCTGTATCTCTTCTTCTTTCTTTAAAAACCCCACAAAAACCCCATTATTCTATAACTCACATAAAGTTAAGAAATGGGGAAGTTTTTAATCTATGCTCTGTTTGTATTTGTAATGATTTACAGTGATTTAAGTTTAACTTCATTAGCAATCTTAGACCCAGTGGATTTCCTAGCATTACAATCAATTAGAAAATCATTAGAAGATATGCCAGGTTCTAATTTCTTTTCTTCATGGGATTTTACTTCTGATCCTTGTAATTTCCCTGGTGTTTATTGTGATGCAAATAAAGTTATAGCATTAAATCTTGGTGATCCAAGAGCTGGTTCTCCTGGTTTATCTGGTCGTCTTCATCCTTCAATTGGTAAACTTTCTGCACTTGCTGAGTTATCTATTGTTCCAGGTAGAATCATGGGTTCATTACCACCAACTCTGTCTCAATTAAAGAATCTTCGGTTTCTTGCTATTAGTAAAAATTTCATTTCAGGTCAAATTCCACCTTCTTTAGCTGAGATTCGTGGTTTAAGAACTCTTGATTTAAGTTATAATCAACTTTCTGGTTCAATTCCTCATTCAATTGGTTCATTAAACTCTCTTTCTAATCTAATTCTTTGTCATAATCATCTTTCTGGTTCAATTCCTCAGTTTTTTTCACAAAGTTTAACACGTTTTGATCTTAAACATAATAATCTTTCTGGGATTATTTCCCCTGTTTCTCTTCCACCTTCATTACAGTTTCTTTCTTTATCTTCAAACCGATTTACTGGTTCAGTTGATCGTCTTTTACTCGGTTAAATCAACTGAGTTATCTTGA


Protein sequences

Name Description Sequence
Afp.1553 translated coding region predicted by ESTScan from UniGene Afp.1553

MGKFLIYALFVFVMIYSDLSLTSLAILDPVDFLALQSIRKSLEDMPGSNFFSSWDFTSDPCNFPGVYCDANKVIALNLGDPRAGSPGLSGRLHPSIGKLSALAELSIVPGRIMGSLPPTLSQLKNLRFLAISKNFISGQIPPSLAEIRGLRTLDLSYNQLSGSIPHSIGSLNSLSNLILCHNHLSGSIPQFFSQSLTRFDLKHNNLSGIISPVSLPPSLQFLSLSSNRFTGSVDRLLLG


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF474
1-233 LEUCINE-RICH REPEAT FAMILY PROTEIN

MGKFLIYALFVFVMIYSDLSLTSLAILDPVDFLALQSIRKSLEDMPGSNFFSSWDFTSDPCNFPGVYCDANKVIALNLGDPRAGSPGLSGRLHPSIGKLSALAELSIVPGRIMGSLPPTLSQLKNLRFLAISKNFISGQIPPSLAEIRGLRTLDLSYNQLSGSIPHSIGSLNSLSNLILCHNHLSGSIPQFFSQSLTRFDLKHNNLSGIISPVSLPPSLQFLSLSSNRFTGSV

HMMPanther: PTHR26393
1-233 FAMILY NOT NAMED,FAMILY NOT NAMED

MGKFLIYALFVFVMIYSDLSLTSLAILDPVDFLALQSIRKSLEDMPGSNFFSSWDFTSDPCNFPGVYCDANKVIALNLGDPRAGSPGLSGRLHPSIGKLSALAELSIVPGRIMGSLPPTLSQLKNLRFLAISKNFISGQIPPSLAEIRGLRTLDLSYNQLSGSIPHSIGSLNSLSNLILCHNHLSGSIPQFFSQSLTRFDLKHNNLSGIISPVSLPPSLQFLSLSSNRFTGSV

superfamily: SSF52058
25-232 L domain-like,LRR

AILDPVDFLALQSIRKSLEDMPGSNFFSSWDFTSDPCNFPGVYCDANKVIALNLGDPRAGSPGLSGRLHPSIGKLSALAELSIVPGRIMGSLPPTLSQLKNLRFLAISKNFISGQIPPSLAEIRGLRTLDLSYNQLSGSIPHSIGSLNSLSNLILCHNHLSGSIPQFFSQSLTRFDLKHNNLSGIISPVSLPPSLQFLSLSSNRFTGS

HMMPfam: PF08263
IPR013210
31-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DFLALQSIRKSLEDMPGSNFFSSWDFTSDPCNFPGVYCD

Gene3D: G3DSA:3.80.10.10
33-233 no description

LALQSIRKSLEDMPGSNFFSSWDFTSDPCNFPGVYCDANKVIALNLGDPRAGSPGLSGRLHPSIGKLSALAELSIVPGRIMGSLPPTLSQLKNLRFLAISKNFISGQIPPSLAEIRGLRTLDLSYNQLSGSIPHSIGSLNSLSNLILCHNHLSGSIPQFFSQSLTRFDLKHNNLSGIISPVSLPPSLQFLSLSSNRFTGSV

ProfileScan: PS51450
IPR001611
125-147 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRFLAISKNFISGQIPPSLAEI

ProfileScan: PS51450
IPR001611
149-171 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRTLDLSYNQLSGSIPHSIGSL

HMMPfam: PF12799
150-191 LRR_4,Leucine Rich repeats (2 copies)

LRTLDLSYNQLSGSIPHSIGSLNSLSNLILCHNHLSGSIPQF

Seg: seg
166-185 seg

HSIGSLNSLSNLILCHNHLS

ProfileScan: PS51450
IPR001611
173-194 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSNLILCHNHLSGSIPQFFSQ

ProfileScan: PS51450
IPR001611
195-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTRFDLKHNNLSGIISPVSLP

Seg: seg
211-226 seg

SPVSLPPSLQFLSLSS

HMMPfam: PF13504
217-230 LRR_7,Leucine rich repeat

PSLQFLSLSSNRFT

ProfileScan: PS51450
IPR001611
218-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQFLSLSSNRFTGSVDRLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox