PRGDB00065595 (Afp.1558)

From PRG Wiki
Jump to: navigation, search
Afp.1558
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71703338 (DR933975)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1125514 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1OS65, mRNA sequence

DNA Sequence

GATCAACCCTGGGAGCGTCTGACAGTTACACAACAACGTAATGCATATCAAGAAGATAAAGAAACACATTTGTACCTAGTAGTAGTTCTATAACAGCAGCACTAGTAAATAGCTGACACAGGATGATAATTTAATACAATAATACTCAATAGCTTGCTCGAGCATCTTCAGTAGTAGCATTGGATGGTGACAGTGAACTGCGAGATGCATCCAAGTCTTCTGCCAATGGCGATTGCTCCACTCGAATGTCCTGAATCATCTTTGCCACCTCAGACATTGTTGGCCTCTTGTCTGCGTGCTCGGCTACACAGGCTAGTCCAACATGGAGCATAGCCACCAACTCTTCCTCAATATTCCTATACCTTAAAAGCTCTGCGTCAAACACTTGCGCTGTACATTCATCTTTAATTACAGATAGAACCCATTTCGGGAGATCCACTCCTTCCTCGTCAATTTTCTGAGCATTCGGAGGACACAATGATGGAGCTCTCCCAGTAAGTACTTCCAGAATCAAGACTCCAAAGCTGTAAACATCAGCCTTTTGAGAAAGTTTCTTGGTTGCGACTTGCTCAGGTGCTTTGTACCCTCCCAGTCTTGCTGTAGCTTGAATTGGATTGAGAAGCAGAGCCAAACCAAAATCAGAAATGCAAGCTACACCATTGCTGTCAAGAAGCACATTTGATGACTTCACATTTCCATGAGGAATGCTTGATGCATTGTGCTCTTCGTGTATTCTAGCAATCCCACGAGCTGCTCCCAACACTATACCAATCCTTGTAGTCCAGTCCAATGGAATCCTTCCTAGCCCGCGATTTCCATGGAGAAGATAATGCAGACT


Protein sequences

Name Description Sequence
Afp.1558 translated coding region predicted by ESTScan from UniGene Afp.1558

SLHYLLHGNRGLGRIPLDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLCPPNAQKIDEEGVDLPKWVLSVIKDECTAQVFDAELLRYRNIEEELVAMLHVGLACVAEHADKRPTMSEVAKMIQDIRVEQSPLAEDLDASRSSLSPSNATTEDARASY

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-219 no description

SLHYLLHGNRGLGRIPLDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLCPPNAQKIDEEGVDLPKWVLSVIKDECTAQVFDAELLRYRNIEEELVAMLHVGLACVAEHADKRPTMSEVAKMIQDIRVEQSPLAEDLDASRSSLSPS

superfamily: SSF56112
IPR011009
1-224 Protein kinase-like (PK-like)
Protein kinase-like domain

SLHYLLHGNRGLGRIPLDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLCPPNAQKIDEEGVDLPKWVLSVIKDECTAQVFDAELLRYRNIEEELVAMLHVGLACVAEHADKRPTMSEVAKMIQDIRVEQSPLAEDLDASRSSLSPSNATTE

ProfileScan: PS50011
IPR000719
1-200 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SLHYLLHGNRGLGRIPLDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLCPPNAQKIDEEGVDLPKWVLSVIKDECTAQVFDAELLRYRNIEEELVAMLHVGLACVAEHADKRPTMSEVAKMIQDIRV

HMMPanther: PTHR24420:SF922
1-209 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

SLHYLLHGNRGLGRIPLDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLCPPNAQKIDEEGVDLPKWVLSVIKDECTAQVFDAELLRYRNIEEELVAMLHVGLACVAEHADKRPTMSEVAKMIQDIRVEQSPLAEDL

HMMPanther: PTHR24420
1-209 FAMILY NOT NAMED,FAMILY NOT NAMED

SLHYLLHGNRGLGRIPLDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLCPPNAQKIDEEGVDLPKWVLSVIKDECTAQVFDAELLRYRNIEEELVAMLHVGLACVAEHADKRPTMSEVAKMIQDIRVEQSPLAEDL

HMMPfam: PF00069
IPR017442
17-122 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LDWTTRIGIVLGAARGIARIHEEHNASSIPHGNVKSSNVLLDSNGVACISDFGLALLLNPIQATARLGGYKAPEQVATKKLSQKADVYSFGVLILEVLTGRAPSLC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox