PRGDB00065597 (Afp.1639)

From PRG Wiki
Jump to: navigation, search
Afp.1639
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71706479 (DR937116)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1128655 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1PF62, mRNA sequence

DNA Sequence

CTTGAGAGCTTGAAAGGATGCCCAGTATATGTTATGGGGAAGCAAGACAGATTATATTTTTACAAAACCTTGTTCACGAACACATCAGCAAAAGCAAACACAATACAACATCAAATACAACAAGTGTTGGTCTGATTTACATATAATAATTATGACCTACTAAATATATCACTGAGACCCAATATATTTGCAACAAAATAATTATCCCCTCCAATTATATGACTTGACCCAAGGTGACACTGCAACTTGATGCACCATCCCCTATCATTCACGAGCAGTTTGTATCATATGTTGCAAGACCCAGCAACTCTGGACCTTCCAGACGAGGGTTGTTTTCAAAGTTGTTTAAAGGGAGGTGTTCAAATGGTCCGCTTGTAGGAATTGTTCCACATAAGTTGTTGTTTGAGACATCCACCACTTTGAGGCTCGGAATGGCAGCAAGTTCCCTTGGGATTGGGCCAGTTAACTGATTGTCGTTAAGCCGCAAGAATACTAGAGACTTCATCTTTCCCAGTGCGGGAGGAATAATCCCTGATATATTATTGTTATATAAGTCCAAGCTTATAAGGCTCTTCAAATTACCAAGCTCAACAGGAATGCTTCCTTGGATTTTGTTTCTATAAAGCTCTAAATACTGAAGACGTTCAAGCTTCCCAAGTTCAGAAACAAGATGGCCTGATAAGTTTGAATTGCCTAGGTCCACACGAGTAACACGATTGTCTTGATCGCAAGTGATATGAAACCAAGTACAAGGGTTAACAAGAGTTGGATCCCAGCTTTGAAGTACGTTAGGATCAGATAAACTTCGTCGAAGTGTGTAAAGAGCATCTCCTTCTGAATTAGCAGATGCGAAAGGAGACGAACAACAACTAATTCTA


Protein sequences

Name Description Sequence
Afp.1639 translated coding region predicted by ESTScan from UniGene Afp.1639

XRISCCSSPFASANSEGDALYTLRRSLSDPNVLQSWDPTLVNPCTWFHITCDQDNRVTRVDLGNSNLSGHLVSELGKLERLQYLELYRNKIQGSIPVELGNLKSLISLDLYNNNISGIIPPALGKMKSLVFLRLNDNQLTGPIPRELAAIPSLKVVDVSNNNLCGTIPTSGPFEHLPLNNFENNPRLEGPELLGLATYDTNCS


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
10-196 L domain-like,LRR

FASANSEGDALYTLRRSLSDPNVLQSWDPTLVNPCTWFHITCDQDNRVTRVDLGNSNLSGHLVSELGKLERLQYLELYRNKIQGSIPVELGNLKSLISLDLYNNNISGIIPPALGKMKSLVFLRLNDNQLTGPIPRELAAIPSLKVVDVSNNNLCGTIPTSGPFEHLPLNNFENNPRLEGPELLGLA

HMMPfam: PF08263
IPR013210
13-52 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ANSEGDALYTLRRSLSDPNVLQSWDPTLVNPCTWFHITCD

Gene3D: G3DSA:3.80.10.10
14-175 no description

NSEGDALYTLRRSLSDPNVLQSWDPTLVNPCTWFHITCDQDNRVTRVDLGNSNLSGHLVSELGKLERLQYLELYRNKIQGSIPVELGNLKSLISLDLYNNNISGIIPPALGKMKSLVFLRLNDNQLTGPIPRELAAIPSLKVVDVSNNNLCGTIPTSGPFEH

HMMPanther: PTHR24420:SF836
14-191 SUBFAMILY NOT NAMED

NSEGDALYTLRRSLSDPNVLQSWDPTLVNPCTWFHITCDQDNRVTRVDLGNSNLSGHLVSELGKLERLQYLELYRNKIQGSIPVELGNLKSLISLDLYNNNISGIIPPALGKMKSLVFLRLNDNQLTGPIPRELAAIPSLKVVDVSNNNLCGTIPTSGPFEHLPLNNFENNPRLEGPE

HMMPanther: PTHR24420
14-191 FAMILY NOT NAMED,FAMILY NOT NAMED

NSEGDALYTLRRSLSDPNVLQSWDPTLVNPCTWFHITCDQDNRVTRVDLGNSNLSGHLVSELGKLERLQYLELYRNKIQGSIPVELGNLKSLISLDLYNNNISGIIPPALGKMKSLVFLRLNDNQLTGPIPRELAAIPSLKVVDVSNNNLCGTIPTSGPFEHLPLNNFENNPRLEGPE

HMMPfam: PF12799
80-118 LRR_4,Leucine Rich repeats (2 copies)

RLQYLELYRNKIQGSIPVELGNLKSLISLDLYNNNISGI

HMMPfam: PF13516
126-148 LRR_6,Leucine Rich repeat

MKSLVFLRLNDNQLTGPIPRELA

HMMPfam: PF00560
IPR001611
152-176 LRR_1
Leucine-rich repeat

SLKVVDVSNNNLCGTIPTSGPFEHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox