PRGDB00065601 (Afp.1794)

From PRG Wiki
Jump to: navigation, search
Afp.1794
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71704253 (DR934890)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1126429 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1P030, mRNA sequence

DNA Sequence

CAACTCTCTTATGTTCATTCTTCTCTCAATCATCCAAATGATGTTCTTCTTCTCATTTCCAACACTAGTAATAGTTTTAGTAGTCTGGGTACCTATAGTGTTGCCATTCACAATTATATTATCAGATTCTGGCTCTCCATCGGCATTAGTTGATGCACCACAAACTGGGTTTTCAATGAACAAAAATGGAGCTAGAACAAATCCTCAAGAGCAAGCAGCTGTGTTTGAAATCATGAAGGCAACTGGAAATGGATGGGCTACTGATATACCGGATGTATGTCGTGGTCGTTGGCATGGAATTGAATGCATGCCGGATAAAGACGAGGTATTTCATGTTGTATCACTTTCATTCGGTGCACTCTCGGATGACACTGCATTTCCCACCTGTGATCAGAAACATTCCTTCATATCTCCTGCTATCACTAAGCTTCCTCACCTGAGAACACTCTTTTTCTACCGTTGTTTTAGCTACAACCCTCAGCCTATCCCAACGTTCTTGGGGCAATTGGGCCCAACACTACAAACATTAGTCCTTAGAGAAAATGGCCATGTAGGTCCAATTCCAACTGAGTTGGGTAATCTGACCAGTTTAAGAGTGTTGGATCTTCACAAAAACAAGCTTAACGGGTCAATACCGGCTTCATTTAGGCGGCTTACACATCTAAGATCCATGGATTTGAGTGTAAATAGATTAACAGGTCAAATTCCGGATTTAAACAACCCAGTTTTGAGCATATTGGATCTAAATCAAAATCTCTTCACAGGTTCTATACCACCTAGTATTGGAAATTGCCCATCTCTTCTAAAGATGGATCTGAGCCGGAACCATCTATCCCGGTCCAATACCCGAACAAATCGGCAACTTAAGGAACTTGGTGCTTATAGATTTTAGCTACAATCAGCTCTTGGGTCCAATA


Protein sequences

Name Description Sequence
Afp.1794 translated coding region predicted by ESTScan from UniGene Afp.1794

XNSLMFILLSIIQMMFFFSFPTLVIVLVVWVPIVLPFTIILSDSGSPSALVDAPQTGFSMNKNGARTNPQEQAAVFEIMKATGNGWATDIPDVCRGRWHGIECMPDKDEVFHVVSLSFGALSDDTAFPTCDQKHSFISPAITKLPHLRTLFFYRCFSYNPQPIPTFLGQLGPTLQTLVLRENGHVGPIPTELGNLTSLRVLDLHKNKLNGSIPASFRRLTHLRSMDLSVNRLTGQIPDLNNPVLSILDLNQNLFTGSIPPSIGNCPSLLKMDLSRNHLSRSNTRTNRQLKELGAYRFXLQSALGSNX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
2-279 FAMILY NOT NAMED,FAMILY NOT NAMED

NSLMFILLSIIQMMFFFSFPTLVIVLVVWVPIVLPFTIILSDSGSPSALVDAPQTGFSMNKNGARTNPQEQAAVFEIMKATGNGWATDIPDVCRGRWHGIECMPDKDEVFHVVSLSFGALSDDTAFPTCDQKHSFISPAITKLPHLRTLFFYRCFSYNPQPIPTFLGQLGPTLQTLVLRENGHVGPIPTELGNLTSLRVLDLHKNKLNGSIPASFRRLTHLRSMDLSVNRLTGQIPDLNNPVLSILDLNQNLFTGSIPPSIGNCPSLLKMDLSRNHLS

Seg: seg
23-36 seg

LVIVLVVWVPIVLP

superfamily: SSF52058
65-281 L domain-like,LRR

ARTNPQEQAAVFEIMKATGNGWATDIPDVCRGRWHGIECMPDKDEVFHVVSLSFGALSDDTAFPTCDQKHSFISPAITKLPHLRTLFFYRCFSYNPQPIPTFLGQLGPTLQTLVLRENGHVGPIPTELGNLTSLRVLDLHKNKLNGSIPASFRRLTHLRSMDLSVNRLTGQIPDLNNPVLSILDLNQNLFTGSIPPSIGNCPSLLKMDLSRNHLSRS

Gene3D: G3DSA:3.80.10.10
89-292 no description

DIPDVCRGRWHGIECMPDKDEVFHVVSLSFGALSDDTAFPTCDQKHSFISPAITKLPHLRTLFFYRCFSYNPQPIPTFLGQLGPTLQTLVLRENGHVGPIPTELGNLTSLRVLDLHKNKLNGSIPASFRRLTHLRSMDLSVNRLTGQIPDLNNPVLSILDLNQNLFTGSIPPSIGNCPSLLKMDLSRNHLSRSNTRTNRQLKEL

HMMPfam: PF13855
172-232 LRR_8,Leucine rich repeat

PTLQTLVLRENGHVGPIPTELGNLTSLRVLDLHKNKLNGSIPASFRRLTHLRSMDLSVNRL

HMMPfam: PF00560
IPR001611
244-265 LRR_1
Leucine-rich repeat

LSILDLNQNLFTGSIPPSIGNC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox