PRGDB00065605 (Afp.2155)

From PRG Wiki
Jump to: navigation, search
Afp.2155
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74565928 (DT762005)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1195854 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YN93, mRNA sequence

DNA Sequence

TTTTACAAAACAGTGACAAGGGAAGAGAAGACCAAGACCATTTATTTTAATTCTTTGATTTAAATTATTATAAGAAGAAAATTCTTCCTTCATGCTTAACTCTGCTTTCATCCTTACCTTTCTTCTCCATCTTTTCCGTGTTTTTTCATCAGAACTAGCAGAGAAATAAAACACAACCCAAGCTTTATTTCTTCATTCTTGAACTATTACTTAGAAGCTTGAAATAAAGGTCATCAAGACTTAAGAAAAGGATCatatatatatatGGGGAATTGTTGTTGTGCAGATGCTCAGGTTGATCATAGAAACTCAAGTAATATAGCTTCAACACCAGGAACATCTAAATACATCAGCAAAGAAAGTGCATTATCTAGTAGTAGTGCTGGAAATAGTATCTTTTCTACCAGCGGAACTATCGATGAATCAAATCCAAATGGGGAGATCTTACCAACCTCAAATTTGAGAATTTTCAGTTTCGCAGAACTGAAAAATGCTACAAAAAATTTTAAATCCGACACAGTCCTTGGTGAAGGAGGTTTTGGAAAAGTTTTCAAAGGTTGGATTGATGAGAAATATCCTGCCAAGAGTGGTAGTGGATATGTTGTTGCCGTTAAGAAGTTAAATTCAGAGAGCATGCAAGGATTTGAAGAATGGCAGGCTGAGGTGAACTTTTTAGGTAGACTTTCTCATCCCAACCTTGTTAGGCTTCTGGGCTACTGCTGGGAGGATAAAGAGCTTCTGCTAGTTTACGAGTTCATGCAAAAAGGAAGTTTGGAGAACCACCTCTTCAGAAGGGGTTTAGCTGTCCAACCAATTCCATGGAACTTACGACTGAAGATAGTGCTTGGTGCAGCTCGAGGACTGGCTTTTTTGCACTCCTCGGAAAAACAAATCATCTACAGGGACTTCAAGGCATCAAATATATTACTT


Protein sequences

Name Description Sequence
Afp.2155 translated coding region predicted by ESTScan from UniGene Afp.2155

MGNCCCADAQVDHRNSSNIASTPGTSKYISKESALSSSSAGNSIFSTSGTIDESNPNGEILPTSNLRIFSFAELKNATKNFKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

Domains

Domain Start-End Description Sequence

Seg: seg
26-48 seg

SKYISKESALSSSSAGNSIFSTS

HMMPanther: PTHR24420:SF531
32-222 SUBFAMILY NOT NAMED

ESALSSSSAGNSIFSTSGTIDESNPNGEILPTSNLRIFSFAELKNATKNFKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

HMMPanther: PTHR24420
32-222 FAMILY NOT NAMED,FAMILY NOT NAMED

ESALSSSSAGNSIFSTSGTIDESNPNGEILPTSNLRIFSFAELKNATKNFKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

superfamily: SSF56112
IPR011009
53-222 Protein kinase-like (PK-like)
Protein kinase-like domain

ESNPNGEILPTSNLRIFSFAELKNATKNFKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

Gene3D: G3DSA:3.30.200.20
63-151 no description

TSNLRIFSFAELKNATKNFKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGY

ProfileScan: PS50011
IPR000719
81-222 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

HMMSmart: SM00219
IPR020635
81-221 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNIL

HMMSmart: SM00220
IPR002290
81-222 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FKSDTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

HMMPfam: PF07714
IPR001245
84-222 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DTVLGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKKLNSESMQGFEEWQAEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

PatternScan: PS00107
IPR017441
87-118 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGKVFKGWIDEKYPAKSGSGYVVAVKK

Gene3D: G3DSA:1.10.510.10
152-222 no description

CWEDKELLLVYEFMQKGSLENHLFRRGLAVQPIPWNLRLKIVLGAARGLAFLHSSEKQIIYRDFKASNILL

PatternScan: PS00108
IPR008271
210-222 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox