PRGDB00065612 (Afp.2619)

From PRG Wiki
Jump to: navigation, search
Afp.2619
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74563444 (DT760589)
Gene Class Mlo-like
Domain Type MLO
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1194438 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YF52, mRNA sequence

DNA Sequence

TTTAATTATGAACAAGCATGGTGAATATACAAGAATTACAGTTGAGCCAGATTTCTAAAATTACTATATCTCCCTCACTACACACACCAAAATAACTTGCATCACTAATCAACATTCGATGCCACTGCACAACCAAAACACTGTGCAACTCCAACTTCAAGGTCTACCTAGGACAGCAGGCTTAACAAATGAGAAGTCGTCTTCATTCGAGGGCTGCCCTCCTTGATTATCATAGGACCGATCGTTTGTTCCAGTTTCTAGGTCACCATTATCCATGTGAGCAATGAGGTTGGCTGTTGATGATGTGGGAGAATTATCACCTTCCGTGTCTGACAAATCAGTTTCGGGGTATCTCCTACTGTTGAAAGATGAGCGCGTTGAGTGCCCAGTAGTCTGAAACCGGTGAAGTGGGTGTGCAGGAGATTGCATTGGTGATACACTTGGGGTGGTTCTTGGAGATTTTCCTGACTTTTCATCTTTCTTCTTTTTAACAGCAGCTCTATGCCAGTTCTTTAGTGCCCTAGATGTCTGTTCATCAAAGATGGATTTCTTCATGTTTGTTCCCATCTGCGTCACTAAGGCATATAGTGGTAGCGTAATGTAGCTGCACAAAACTTGGACTGCGACCCCAAGAGCAACTCTTATAACTATGAGAGTGAAATTCTCATGGAAGCAAGATTTCAGCCCAAACTCGTACCATATCCATAAGAAATAACTGATTTGGAATGCATTCTGAAAGAGGGTGAAATGAATGAGATATAGAATCAGTGGAGGCCAACTAAACCAAAAATATTTGTCACTGACTTGCACAAGAGGAATCCCTTGAACCACTGCATGTCTTTCTTGGATGTCAATGGCCATTTGCGTTATTATGGCTTGGAGCTTTGTACCAACAGCTAATATTATAACAAGAGGAATTATGGATGCCCAAAACAACGCTTGCCACCCATTAACATTTA


Protein sequences

Name Description Sequence
Afp.2619 translated coding region predicted by ESTScan from UniGene Afp.2619

XNVNGWQALFWASIIPLVIILAVGTKLQAIITQMAIDIQERHAVVQGIPLVQVSDKYFWFSWPPLILYLIHFTLFQNAFQISYFLWIWYEFGLKSCFHENFTLIVIRVALGVAVQVLCSYITLPLYALVTQMGTNMKKSIFDEQTSRALKNWHRAAVKKKKDEKSGKSPRTTPSVSPMQSPAHPLHRFQTTGHSTRSSFNSRRYPETDLSDTEGDNSPTSSTANLIAHMDNGDLETGTNDRSYDNQGGQPSNEDDFSFVKPAVLGRP

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
2-185 Mlo
Mlo-related protein

NVNGWQALFWASIIPLVIILAVGTKLQAIITQMAIDIQERHAVVQGIPLVQVSDKYFWFSWPPLILYLIHFTLFQNAFQISYFLWIWYEFGLKSCFHENFTLIVIRVALGVAVQVLCSYITLPLYALVTQMGTNMKKSIFDEQTSRALKNWHRAAVKKKKDEKSGKSPRTTPSVSPMQSPAHPL

Seg: seg
158-167 seg

KKKKDEKSGK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox