PRGDB00065630 (Afp.3693)

From PRG Wiki
Jump to: navigation, search
Afp.3693
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74560618 (DT759037)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1192886 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Y644, mRNA sequence

DNA Sequence

TGACATTAACCGCTACATTGAAACATTATTTTACATTGTTCACGATCAACATAAGGATAACATAAAACCCTATTTCTTGCATGGAGATAAAGGAGAACCACACAAGCAATCATTTCCTAGAAATGCCTGAACTGGAAACTTGGTCACCGGAAGTTGGCCACACAAATGGTTATGACTTAAATCTACCTTCTTCAATCCAGAAATGCTCTGCGGAACTTTACCAAACACTTGGTTTCTAGCCAAAACCAAATTCTTTAAGCTCTTGGGTATCAAGATATTCGACATATTAAACCGTAACTGATTACCTGATGCCCAAAAGCCTTTTAACAATGTGGTCTGGTTCAACAAACCAACAGGACTACCCGAAATTTGATTATCCGATAAATCAATAAAATCGTAGAAATATGTTTGTGTTGGCTTAAAATCCTCTAACCGGAACTTCAACCCACATCCAGAAAGCTTGAGTGAAAATATAATAGGTGATGTTGCAACCCATTTTGGTATTGTACCTAAATTAAATTTATTGTAAGAAAGATCGAGCGATTCGATTCCCCTTACATTTAATTCAGGAAATGGATCCACTAAACGATTGCGCCTAAGATTAAGATTAAAAATCTTAGTGAGATTCTTAAAACTTAACGGTACAGTACCTGTCAGTTGATTCGACGACAGGTCAAGTGTGTCGAGCCGTTGGAAATTGCCGAAATAATCCGGAATTTTACCAGTAAGAAGATTATGGCTAATCTCAAGAGATCCAAGTTGTGGTGCCAATGCTGAAAGTGTAGGTGGCAATTCACCAGTGAGCTTATTGTAAGAGAGGGTTAAAGCTCGGAGTTCGGAAAATGATGTGAAAAATCCGGTATTTTACCGGAAATTGATCTTCTCGAGATTAAGTAAGTCAAGTTCTTTAATTGTCGATTCCATCGGGAA


Protein sequences

Name Description Sequence
Afp.3693 translated coding region predicted by ESTScan from UniGene Afp.3693

FPMESTIKELDLLNLEKINFRXNTGFFTSFSELRALTLSYNKLTGELPPTLSALAPQLGSLEISHNLLTGKIPDYFGNFQRLDTLDLSSNQLTGTVPLSFKNLTKIFNLNLRRNRLVDPFPELNVRGIESLDLSYNKFNLGTIPKWVATSPIIFSLKLSGCGLKFRLEDFKPTQTYFYDFIDLSDNQISGSPVGLLNQTTLLKGFWASGNQLRFNMSNILIPKSLKNLVLARNQVFGKVPQSISGLKKVDLSHNHLCGQLPVTKFPVQAFLGNDCLCGSPLSPCKK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF510
2-283 DISEASE RESISTANCE PROTEIN-RELATED / LRR PROTEIN-RELATED

PMESTIKELDLLNLEKINFRXNTGFFTSFSELRALTLSYNKLTGELPPTLSALAPQLGSLEISHNLLTGKIPDYFGNFQRLDTLDLSSNQLTGTVPLSFKNLTKIFNLNLRRNRLVDPFPELNVRGIESLDLSYNKFNLGTIPKWVATSPIIFSLKLSGCGLKFRLEDFKPTQTYFYDFIDLSDNQISGSPVGLLNQTTLLKGFWASGNQLRFNMSNILIPKSLKNLVLARNQVFGKVPQSISGLKKVDLSHNHLCGQLPVTKFPVQAFLGNDCLCGSPLSP

HMMPanther: PTHR24420
2-283 FAMILY NOT NAMED,FAMILY NOT NAMED

PMESTIKELDLLNLEKINFRXNTGFFTSFSELRALTLSYNKLTGELPPTLSALAPQLGSLEISHNLLTGKIPDYFGNFQRLDTLDLSSNQLTGTVPLSFKNLTKIFNLNLRRNRLVDPFPELNVRGIESLDLSYNKFNLGTIPKWVATSPIIFSLKLSGCGLKFRLEDFKPTQTYFYDFIDLSDNQISGSPVGLLNQTTLLKGFWASGNQLRFNMSNILIPKSLKNLVLARNQVFGKVPQSISGLKKVDLSHNHLCGQLPVTKFPVQAFLGNDCLCGSPLSP

Gene3D: G3DSA:3.80.10.10
14-282 no description

NLEKINFRXNTGFFTSFSELRALTLSYNKLTGELPPTLSALAPQLGSLEISHNLLTGKIPDYFGNFQRLDTLDLSSNQLTGTVPLSFKNLTKIFNLNLRRNRLVDPFPELNVRGIESLDLSYNKFNLGTIPKWVATSPIIFSLKLSGCGLKFRLEDFKPTQTYFYDFIDLSDNQISGSPVGLLNQTTLLKGFWASGNQLRFNMSNILIPKSLKNLVLARNQVFGKVPQSISGLKKVDLSHNHLCGQLPVTKFPVQAFLGNDCLCGSPLS

superfamily: SSF52058
27-285 L domain-like,LRR

FTSFSELRALTLSYNKLTGELPPTLSALAPQLGSLEISHNLLTGKIPDYFGNFQRLDTLDLSSNQLTGTVPLSFKNLTKIFNLNLRRNRLVDPFPELNVRGIESLDLSYNKFNLGTIPKWVATSPIIFSLKLSGCGLKFRLEDFKPTQTYFYDFIDLSDNQISGSPVGLLNQTTLLKGFWASGNQLRFNMSNILIPKSLKNLVLARNQVFGKVPQSISGLKKVDLSHNHLCGQLPVTKFPVQAFLGNDCLCGSPLSPCK

HMMPfam: PF00560
IPR001611
33-54 LRR_1
Leucine-rich repeat

LRALTLSYNKLTGELPPTLSAL

HMMPfam: PF13855
56-116 LRR_8,Leucine rich repeat

PQLGSLEISHNLLTGKIPDYFGNFQRLDTLDLSSNQLTGTVPLSFKNLTKIFNLNLRRNRL

FPrintScan: PR00019
82-95 LEURICHRPT,Leucine-rich repeat signature

LDTLDLSSNQLTGT

FPrintScan: PR00019
243-256 LEURICHRPT,Leucine-rich repeat signature

ISGLKKVDLSHNHL

HMMPfam: PF00560
IPR001611
246-265 LRR_1
Leucine-rich repeat

LKKVDLSHNHLCGQLPVTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox