PRGDB00065632 (Afp.3746)

From PRG Wiki
Jump to: navigation, search
Afp.3746
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 75452139 (DT763183)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1197032 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YV01, mRNA sequence

DNA Sequence

ATTGGCTTCAAGTGTTGGGTCTGTTTCTTTTATTATTGCTGTAGTGGGGTTTCTTCTTTGGTGGAGATACAGACACAACCAGCAGATTTTCTTTGATGTTAATGATCAATATGATCCAGAAGTACGCTTGGGTCATCTGAAGAGGTATTCTTTTAAGGAGCTTCGTGCAGCCACTGATCATTTCAACCCAAAGAACATAATAGGGAGGGGTGGATTCGGCATTGTTTACAAGGGATGCCTGCAAGATGGGACTATTGTGGCAGTTAAAAGGTTGAAAGACTACAATGCAGTTGGTGGTGAAGTTCAGTTTCAGACAGAAGTTGAGATGATAAGTTTGGCAGTTCATCGACATCTCCTCCGCCTCTGTGGGTTTTGCTCGACTGAGAATGAGAGGCTCCTTGTATATCCATATATGCCAAATGGAAGCGTTGCATCTCGTTTGAGAGATACTATTCACAGCAATCCCGCTTTAGATTGGTCAAGACGAAAAAATATAGCATTAGGAACAGCTCGAGGTTTACTTTATTTGCATGAGCAGTGCGATCCCAAAATTATTCATCGTGATGTGAAAGCTGCCAATATTCTTCTTGATGAAGACTTTGAAGCAGTTGTTGGAGACTTCGGGTTGGCAAAGCTCCTGGATCATCGCGATTCTCATGTGAGTACTGCTGTGCGTGGAACTGTTGGTCACATTGCTCCAGAGTATTTATCCACTGGCCAATCATCTGAAAAAACAGATGTGTTTGGTTTCGGTATCTTGCTCCTAGAGCTAATTACAGGTCAGAAGGCGTTAGATTTTGGACGAGTATCGAACC


Protein sequences

Name Description Sequence
Afp.3746 translated coding region predicted by ESTScan from UniGene Afp.3746

XLASSVGSVSFIIAVVGFLLWWRYRHNQQIFFDVNDQYDPEVRLGHLKRYSFKELRAATDHFNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVSNX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF851
2-272 SUBFAMILY NOT NAMED

LASSVGSVSFIIAVVGFLLWWRYRHNQQIFFDVNDQYDPEVRLGHLKRYSFKELRAATDHFNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVSN

HMMPanther: PTHR24420
2-272 FAMILY NOT NAMED,FAMILY NOT NAMED

LASSVGSVSFIIAVVGFLLWWRYRHNQQIFFDVNDQYDPEVRLGHLKRYSFKELRAATDHFNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVSN

superfamily: SSF56112
IPR011009
32-266 Protein kinase-like (PK-like)
Protein kinase-like domain

FDVNDQYDPEVRLGHLKRYSFKELRAATDHFNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALD

Gene3D: G3DSA:2.60.120.200
IPR013320
35-81 no description
Concanavalin A-like lectin/glucanase, subgroup

NDQYDPEVRLGHLKRYSFKELRAATDHFNPKNIIGRGGFGIVYKGCL

ProfileScan: PS50011
IPR000719
62-273 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVSNX

HMMSmart: SM00220
IPR002290
62-267 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDF

HMMSmart: SM00219
IPR020635
62-272 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNPKNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVSN

HMMPfam: PF00069
IPR017442
65-263 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KNIIGRGGFGIVYKGCLQDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYMPNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQK

PatternScan: PS00107
IPR017441
68-90 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFGIVYKGCLQDGTIVAVK

Gene3D: G3DSA:3.30.200.20
82-139 no description

QDGTIVAVKRLKDYNAVGGEVQFQTEVEMISLAVHRHLLRLCGFCSTENERLLVYPYM

Gene3D: G3DSA:1.10.510.10
140-263 no description

PNGSVASRLRDTIHSNPALDWSRRKNIALGTARGLLYLHEQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQK

PatternScan: PS00108
IPR008271
185-197 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox