PRGDB00065639 (Afp.4086)

From PRG Wiki
Jump to: navigation, search
Afp.4086
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 75455171 (DT765191)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1199040 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Z723, mRNA sequence

DNA Sequence

GCTTGCAGAGCAAAAATGGAGAAAACCAATTCCATTTCTATCTACATTTTCTCATTTCTCCTTCTTCTTCCATTCTCATACCAACAATATTCCTCAAATCCAGATATCAATGCACTACTAACTTTCAAATCTGCTTCAGATTTATCAAACTCACTCACAACTTGGAACAAATCCACTAATGTTTGCTCATGGTCTGGTGTTTCTTGTATTCGAAACCGTGTTTCTCATCTTAATCTTGAAGGTCTTAGTCTTACTGGTAGTTTCGAAGCTTTAGCTTCTTTAAATGAACTCCGTATTCTCAGTCTTAAACAAAACTATCTTTCAGGTTCGATTCCCGATCTTTCTAAACTCAAAGCTTTAAAACTACTCTTTCTCTCTCACAATAACTTTTCCGGCGAGTTTCCGGCGTCTGTGTTAACTCTTTACAAGTTATTTCGTCTTGATCTATCTTACAACAACTTCTCCGGTCAGATTCCGGCGAATATTAACCATTTAACTCGTCTTCTTACTCTTAGACTTGAAGAGAACCAGTTTTCTGGACCGATTTCTACTTTCAATCTTCCTACTTTGCAAGATTTCAATGTATCTGGTAACCGATTTTCAGGTGAAATTCCTCAAACCTTGTCTCGATTTCCGGAAACAGCTTTTCAACGGAATGCGGTTTTGTGTGGTTCGCCTTTGGTTCAATGCAAGAGTATTACTAGTGATCCAAGTAAACCTGGTGCTATTGCTTCTTCATTAAGTCCGATTGGTTCAACTCCGGCAATAGTTTCTTCATCTCCGACTGAAGAACCAGGAGTTCTTACACCAATTTCAGTTTCTAGTCATAGTGGAAAAGGAAAGCTAAGTTTACTCGCCGTAATCGCTATTATAATCGGCGATGTTTTGATTCTAGCATTAA


Protein sequences

Name Description Sequence
Afp.4086 translated coding region predicted by ESTScan from UniGene Afp.4086

MEKTNSISIYIFSFLLLLPFSYQQYSSNPDINALLTFKSASDLSNSLTTWNKSTNVCSWSGVSCIRNRVSHLNLEGLSLTGSFEALASLNELRILSLKQNYLSGSIPDLSKLKALKLLFLSHNNFSGEFPASVLTLYKLFRLDLSYNNFSGQIPANINHLTRLLTLRLEENQFSGPISTFNLPTLQDFNVSGNRFSGEIPQTLSRFPETAFQRNAVLCGSPLVQCKSITSDPSKPGAIASSLSPIGSTPAIVSSSPTEEPGVLTPISVSSHSGKGKLSLLAVIAIIIGDVLILALX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF923
1-295 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

MEKTNSISIYIFSFLLLLPFSYQQYSSNPDINALLTFKSASDLSNSLTTWNKSTNVCSWSGVSCIRNRVSHLNLEGLSLTGSFEALASLNELRILSLKQNYLSGSIPDLSKLKALKLLFLSHNNFSGEFPASVLTLYKLFRLDLSYNNFSGQIPANINHLTRLLTLRLEENQFSGPISTFNLPTLQDFNVSGNRFSGEIPQTLSRFPETAFQRNAVLCGSPLVQCKSITSDPSKPGAIASSLSPIGSTPAIVSSSPTEEPGVLTPISVSSHSGKGKLSLLAVIAIIIGDVLILAL

HMMPanther: PTHR24420
1-295 FAMILY NOT NAMED,FAMILY NOT NAMED

MEKTNSISIYIFSFLLLLPFSYQQYSSNPDINALLTFKSASDLSNSLTTWNKSTNVCSWSGVSCIRNRVSHLNLEGLSLTGSFEALASLNELRILSLKQNYLSGSIPDLSKLKALKLLFLSHNNFSGEFPASVLTLYKLFRLDLSYNNFSGQIPANINHLTRLLTLRLEENQFSGPISTFNLPTLQDFNVSGNRFSGEIPQTLSRFPETAFQRNAVLCGSPLVQCKSITSDPSKPGAIASSLSPIGSTPAIVSSSPTEEPGVLTPISVSSHSGKGKLSLLAVIAIIIGDVLILAL

Seg: seg
6-27 seg

SISIYIFSFLLLLPFSYQQYSS

superfamily: SSF52058
24-226 L domain-like,LRR

QYSSNPDINALLTFKSASDLSNSLTTWNKSTNVCSWSGVSCIRNRVSHLNLEGLSLTGSFEALASLNELRILSLKQNYLSGSIPDLSKLKALKLLFLSHNNFSGEFPASVLTLYKLFRLDLSYNNFSGQIPANINHLTRLLTLRLEENQFSGPISTFNLPTLQDFNVSGNRFSGEIPQTLSRFPETAFQRNAVLCGSPLVQCK

HMMPfam: PF08263
IPR013210
28-64 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NPDINALLTFKSASDLSNSLTTWNKSTNVCSWSGVSC

Gene3D: G3DSA:3.80.10.10
32-206 no description

NALLTFKSASDLSNSLTTWNKSTNVCSWSGVSCIRNRVSHLNLEGLSLTGSFEALASLNELRILSLKQNYLSGSIPDLSKLKALKLLFLSHNNFSGEFPASVLTLYKLFRLDLSYNNFSGQIPANINHLTRLLTLRLEENQFSGPISTFNLPTLQDFNVSGNRFSGEIPQTLSRF

ProfileScan: PS51450
IPR001611
91-113 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRILSLKQNYLSGSIPDLSKLK

Seg: seg
109-121 seg

LSKLKALKLLFLS

ProfileScan: PS51450
IPR001611
114-135 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKLLFLSHNNFSGEFPASVLT

ProfileScan: PS51450
IPR001611
138-161 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLFRLDLSYNNFSGQIPANINHLT

HMMPfam: PF00560
IPR001611
139-160 LRR_1
Leucine-rich repeat

LFRLDLSYNNFSGQIPANINHL

Seg: seg
160-170 seg

LTRLLTLRLEE

HMMPfam: PF13516
182-204 LRR_6,Leucine Rich repeat

LPTLQDFNVSGNRFSGEIPQTLS

Seg: seg
267-280 seg

SVSSHSGKGKLSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox