PRGDB00065646 (Afp.4453)

From PRG Wiki
Jump to: navigation, search
Afp.4453
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 75453129 (DT763843)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1197692 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YY86, mRNA sequence

DNA Sequence

CtcttttcttcaaatttatgattttatttcacaaatttctgattttttGGTGGTTTAATTGGATCTTTAAGAAATCTATGTGGGTTTTGTTTTCTGACTATGTTGAAGTAATAAAGTTCAAATCTTGATGAAAATAATTTCGTATTTTAAGTTTTTAATGGAATTTAAGATTGAGTTGTGGTTTTAAAGTCTGAATTAGGGTTAGGGTTTGAttttttttgtttttaattttttCCAAATGAGTTGTTTTTCTTGTTTGAGTCTTCGCCGTCGTCGTAATGTAAGGAGCATTGAAGATGGTAGTGGAAATCGATCTAATCCTCACTATTCTGTTGATTCATCAGAAAATGGTAAAAAGAAGAACTTGGCTTACAATAGAGATGAGAACAATATTAATCGGAAAAGAAGTGCGCGAAGCTACACATTTCGTGAGCTGGCTACTGCAACCCACAATTTCAAAATTAATAATTTGATTGGGGAAGGAGGTTTTGGTAGGGTTTATAAAGGTCGCCTCGAAACAGGACAGATTGTTGCCATCAAACAACTTGACCAAAATGGCCTTCAGGGAAATCAAGAATTCATTGTGGAGGTTCTCATGTTAAGTCTGCTGCATCATTCTAATCTTGTCAATTTGATCGGATATTGTGCTGATGGTGATCAAAGGCTTTTGATTTATGAGTACATGCCTATGGGAAGCCTAGAAAAGCATCTTTTTGATGTGGCCCTTGATAAAAAGCCTTTAGAATGGAACACACGTATAAAAATTGCTGTCGGTGCTGCTCGCGGCCTTGAATATCTGCATTGCAAAGCTGACCCTCCAGTCATTTACCGTGACTT


Protein sequences

Name Description Sequence
Afp.4453 translated coding region predicted by ESTScan from UniGene Afp.4453

MSCFSCLSLRRRRNVRSIEDGSGNRSNPHYSVDSSENGKKKNLAYNRDENNINRKRSARSYTFRELATATHNFKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRDX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF700
1-199 SUBFAMILY NOT NAMED

MSCFSCLSLRRRRNVRSIEDGSGNRSNPHYSVDSSENGKKKNLAYNRDENNINRKRSARSYTFRELATATHNFKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRD

HMMPanther: PTHR24420
1-199 FAMILY NOT NAMED,FAMILY NOT NAMED

MSCFSCLSLRRRRNVRSIEDGSGNRSNPHYSVDSSENGKKKNLAYNRDENNINRKRSARSYTFRELATATHNFKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRD

Seg: seg
10-13 seg

RRRR

superfamily: SSF56112
IPR011009
43-199 Protein kinase-like (PK-like)
Protein kinase-like domain

LAYNRDENNINRKRSARSYTFRELATATHNFKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRD

Gene3D: G3DSA:3.30.200.20
53-134 no description

NRKRSARSYTFRELATATHNFKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIG

ProfileScan: PS50011
IPR000719
73-200 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRDX

HMMSmart: SM00219
IPR020635
73-200 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRDX

HMMSmart: SM00220
IPR002290
73-195 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FKINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPV

HMMPfam: PF07714
IPR001245
74-190 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KINNLIGEGGFGRVYKGRLETGQIVAIKQLDQNGLQGNQEFIVEVLMLSLLHHSNLVNLIGYCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCK

PatternScan: PS00107
IPR017441
79-101 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGRVYKGRLETGQIVAIK

Seg: seg
118-132 seg

VLMLSLLHHSNLVNL

Gene3D: G3DSA:1.10.510.10
135-199 no description

YCADGDQRLLIYEYMPMGSLEKHLFDVALDKKPLEWNTRIKIAVGAARGLEYLHCKADPPVIYRD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox