PRGDB00065651 (Afp.4689)

From PRG Wiki
Jump to: navigation, search
Afp.4689
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71720551 (DR951188)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1142727 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1RT08, mRNA sequence

DNA Sequence

TGCAATCAAAGAAAAATTCCAATATAGAACACTGAAATGACATTTAATTTACAAATATGAATTACAAACGCCAGGCAATTTACTAAATTATGAAAACTTGGGTTTGGGCATGGGCATGGGCATGGGCATGTGCATGGACAACTCTTCGGAATGCACAGAACTTAATTTTTGAATCCAGTTCCGTAGTCCCTTCTTATGATCGCTGCAAGTTGAGTCTCGAACTAGTTTTAATGTACCGTCAAGGGCAAACGAAGATTCAAACTTCTCAAATACCTTTACAATCTGCCAGAAGTCAGGTCTCTTTTCAGGATGCAACGCCCAACATTGCTCTATCAAAGCTCTCAGAACAGGAGGGCAATCCACAGGGATAATAGGTCTCAAATTCTTATTGACAACAGCAAAAGCAGCTTGAACAGGTGTCATACGTTCATAGGGGATAACTCCAGCTACTAATTCCCATAAGACAAGTCCAAAGCTGTAAACATCAACCTTTCGTCCATAAGGTTTGTGTTTGATCACCTCAGGAGCCATCCATCGATATGTCCCCGGGTCGTCAACTAATGAATCAACAAATGCTTCCTCACAAGCTATTCCAAAATCTGCAACTTTCAAGTTACACTGTTCGTCGAAAAGAATATTTTCGGGCTTAAGATCACGATGAATGACACCTTGTGAGTGTATGTACTCCATTCCTCGAGCTATATTCAAAGCAATTGCAATCAATTTTTCTAAAGGAAGAGATTTTTCTTTAAATGTGTGCAAGAATGCCCTCAACGAACCCCCTGAAAGATACTCGGTGATAATACAAAAGACCGGTGATTCTCTACATGCTCCCACCAACTTAATTACATTTGGATGATGTAGACGAGATAGAAGAGTAACTTCTCTTTTGAATTGCTTTTCTAGCTGAGCCGT


Protein sequences

Name Description Sequence
Afp.4689 translated coding region predicted by ESTScan from UniGene Afp.4689

TAQLEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVFEKFESSFALDGTLKLVRDSTCSDHKKGLRNWIQKLSSVHSEELSMHMPMPMPMPKPKFS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-220 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

TAQLEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVFEKFE

HMMSmart: SM00220
IPR002290
1-216 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

TAQLEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVF

HMMSmart: SM00219
IPR020635
1-216 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

TAQLEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVF

HMMPanther: PTHR23257:SF81
2-222 PROTEIN-TYROSINE KINASE,PROTEIN-TYROSINE KINASE

AQLEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVFEKFESS

HMMPanther: PTHR23257
2-222 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

AQLEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVFEKFESS

Gene3D: G3DSA:3.30.200.20
4-72 no description

LEKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNI

HMMPfam: PF07714
IPR001245
5-215 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EKQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKV

superfamily: SSF56112
IPR011009
6-275 Protein kinase-like (PK-like)
Protein kinase-like domain

KQFKREVTLLSRLHHPNVIKLVGACRESPVFCIITEYLSGGSLRAFLHTFKEKSLPLEKLIAIALNIARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVKVFEKFESSFALDGTLKLVRDSTCSDHKKGLRNWIQKLSSVHSEELSMHMPMPMPMPKPKFS

FPrintScan: PR00109
IPR001245
40-53 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYLSGGSLRAFLH

Gene3D: G3DSA:1.10.510.10
73-214 no description

ARGMEYIHSQGVIHRDLKPENILFDEQCNLKVADFGIACEEAFVDSLVDDPGTYRWMAPEVIKHKPYGRKVDVYSFGLVLWELVAGVIPYERMTPVQAAFAVVNKNLRPIIPVDCPPVLRALIEQCWALHPEKRPDFWQIVK

FPrintScan: PR00109
IPR001245
78-96 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YIHSQGVIHRDLKPENILF

PatternScan: PS00108
IPR008271
84-96 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPENILF

FPrintScan: PR00109
IPR001245
124-134 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
143-165 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVYSFGLVLWELVAGVIPYERM

FPrintScan: PR00109
IPR001245
187-209 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CPPVLRALIEQCWALHPEKRPDF

Seg: seg
261-273 seg

MHMPMPMPMPKPK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox