PRGDB00065654 (Afp.4859)

From PRG Wiki
Jump to: navigation, search
Afp.4859
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 75453410 (DT764040)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1197889 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Z014, mRNA sequence

DNA Sequence

ATCTGCCACCTGCTATAGGAGAGCTCCAAATGCTGAAATCATTAGACATATCCTTTAACTTAATAGTCAGTATACCTGAAGAGATTGGCTCTGCAACCTCTCTTGTCAAGCTTGATTGCTCCAACAATTTGCTCAAAGAACTTCCAAGCTCTCTTGGAGGATGCCTAGATTTGTCGGACCTCAAGGCATCAAATAATTGCATTACAAACTTGCCAGAAGATTTGGTGAACTGTTCAAAATTGACGAAATTGGATGTGGAGGGAAATAAGTTGACAGTGTTGTGCAAAAACAATATTATCTCGTGGACTTCACTTACGGAACTTAATGCCTCAAAGAACTTGCTCATCAGTATCCCAGAGAATATTGGACTTCTTTCACGAGTTGTTCGTCTTGATTTCCATCAGAACAAGATTTCCTCTATTCCATCATCAATCATGGGTTGCAGTTCCCTTGCTGAGTTCTATATGGGAAACAATATGCTCACCTCCTTACCGTCAGAGATAGGGGCACTTTCCCGCTTGGGAACATTAGATCTTCACTCAAATCAGTTGAAGGAATTTCCAGCAGGGGCTTGCAAACTGCGTCTTTCAGTCCTGGATTTGTCAAACAACACATTGTCTGGTCTGCCTCCAGAAATTGGCACAATGACGACTCTTAGGAAGCTTTTGCTCAGTGGAAATCCTATGCGAACTCTTCGAAGTTCATTGGTATCTGGACCTACTGCTGCATTATTGAAGTATCTTCGAAGTAGACTTTCATCTGATGAGGAATCTGGATCTGCCAAAACTCCTGCGAAAGAAGATCACATATCAATGGCAGCACGCTTATCTATCTCTACCAAAGGAACTTTCTCTAACTGGGTTGGGTCTGAACACTGTTCCATCTGAAGTATGGGAATCTGGTGAT


Protein sequences

Name Description Sequence
Afp.4859 translated coding region predicted by ESTScan from UniGene Afp.4859

XLPPAIGELQMLKSLDISFNLIVSIPEEIGSATSLVKLDCSNNLLKELPSSLGGCLDLSDLKASNNCITNLPEDLVNCSKLTKLDVEGNKLTVLCKNNIISWTSLTELNASKNLLISIPENIGLLSRVVRLDFHQNKISSIPSSIMGCSSLAEFYMGNNMLTSLPSEIGALSRLGTLDLHSNQLKEFPAGACKLRLSVLDLSNNTLSGLPPEIGTMTTLRKLLLSGNPMRTLRSSLVSGPTAALLKYLRSRLSSDEESGSAKTPAKEDHISMAAAYLSLPKELSLTGLGLNTVPSEVWESGD


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-229 L domain-like,LRR

XLPPAIGELQMLKSLDISFNLIVSIPEEIGSATSLVKLDCSNNLLKELPSSLGGCLDLSDLKASNNCITNLPEDLVNCSKLTKLDVEGNKLTVLCKNNIISWTSLTELNASKNLLISIPENIGLLSRVVRLDFHQNKISSIPSSIMGCSSLAEFYMGNNMLTSLPSEIGALSRLGTLDLHSNQLKEFPAGACKLRLSVLDLSNNTLSGLPPEIGTMTTLRKLLLSGNPM

Gene3D: G3DSA:3.80.10.10
2-84 no description

LPPAIGELQMLKSLDISFNLIVSIPEEIGSATSLVKLDCSNNLLKELPSSLGGCLDLSDLKASNNCITNLPEDLVNCSKLTKL

HMMPanther: PTHR23155:SF281
2-285 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LPPAIGELQMLKSLDISFNLIVSIPEEIGSATSLVKLDCSNNLLKELPSSLGGCLDLSDLKASNNCITNLPEDLVNCSKLTKLDVEGNKLTVLCKNNIISWTSLTELNASKNLLISIPENIGLLSRVVRLDFHQNKISSIPSSIMGCSSLAEFYMGNNMLTSLPSEIGALSRLGTLDLHSNQLKEFPAGACKLRLSVLDLSNNTLSGLPPEIGTMTTLRKLLLSGNPMRTLRSSLVSGPTAALLKYLRSRLSSDEESGSAKTPAKEDHISMAAAYLSLPKELSL

HMMPanther: PTHR23155
2-285 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LPPAIGELQMLKSLDISFNLIVSIPEEIGSATSLVKLDCSNNLLKELPSSLGGCLDLSDLKASNNCITNLPEDLVNCSKLTKLDVEGNKLTVLCKNNIISWTSLTELNASKNLLISIPENIGLLSRVVRLDFHQNKISSIPSSIMGCSSLAEFYMGNNMLTSLPSEIGALSRLGTLDLHSNQLKEFPAGACKLRLSVLDLSNNTLSGLPPEIGTMTTLRKLLLSGNPMRTLRSSLVSGPTAALLKYLRSRLSSDEESGSAKTPAKEDHISMAAAYLSLPKELSL

HMMSmart: SM00369
IPR003591
9-32 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQMLKSLDISFNLIVSIPEEIGSA

HMMSmart: SM00364
9-28 Leucine-rich repeats, bacterial type

LQMLKSLDISFNLIVSIPEE

ProfileScan: PS51450
IPR001611
11-32 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLKSLDISFNLIVSIPEEIGSA

HMMPfam: PF00560
IPR001611
12-30 LRR_1
Leucine-rich repeat

LKSLDISFNLIVSIPEEIG

HMMSmart: SM00364
32-51 Leucine-rich repeats, bacterial type

ATSLVKLDCSNNLLKELPSS

HMMSmart: SM00369
IPR003591
33-55 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

TSLVKLDCSNNLLKELPSSLGGC

ProfileScan: PS51450
IPR001611
34-55 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVKLDCSNNLLKELPSSLGGC

HMMPfam: PF13855
34-91 LRR_8,Leucine rich repeat

SLVKLDCSNNLLKELPSSLGGCLDLSDLKASNNCITNLPEDLVNCSKLTKLDVEGNKL

Seg: seg
48-61 seg

LPSSLGGCLDLSDL

HMMSmart: SM00364
55-74 Leucine-rich repeats, bacterial type

CLDLSDLKASNNCITNLPED

ProfileScan: PS51450
IPR001611
57-79 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLSDLKASNNCITNLPEDLVNCS

HMMSmart: SM00364
78-97 Leucine-rich repeats, bacterial type

CSKLTKLDVEGNKLTVLCKN

ProfileScan: PS51450
IPR001611
80-101 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTKLDVEGNKLTVLCKNNIIS

Gene3D: G3DSA:3.80.10.10
85-256 no description

DVEGNKLTVLCKNNIISWTSLTELNASKNLLISIPENIGLLSRVVRLDFHQNKISSIPSSIMGCSSLAEFYMGNNMLTSLPSEIGALSRLGTLDLHSNQLKEFPAGACKLRLSVLDLSNNTLSGLPPEIGTMTTLRKLLLSGNPMRTLRSSLVSGPTAALLKYLRSRLSSDE

ProfileScan: PS51450
IPR001611
104-125 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELNASKNLLISIPENIGLL

HMMSmart: SM00364
104-121 Leucine-rich repeats, bacterial type

SLTELNASKNLLISIPEN

HMMSmart: SM00369
IPR003591
125-148 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSRVVRLDFHQNKISSIPSSIMGC

ProfileScan: PS51450
IPR001611
127-148 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RVVRLDFHQNKISSIPSSIMGC

Seg: seg
138-150 seg

ISSIPSSIMGCSS

HMMSmart: SM00364
148-167 Leucine-rich repeats, bacterial type

CSSLAEFYMGNNMLTSLPSE

ProfileScan: PS51450
IPR001611
150-171 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAEFYMGNNMLTSLPSEIGAL

HMMSmart: SM00369
IPR003591
171-194 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSRLGTLDLHSNQLKEFPAGACKL

HMMSmart: SM00364
171-190 Leucine-rich repeats, bacterial type

LSRLGTLDLHSNQLKEFPAG

ProfileScan: PS51450
IPR001611
173-194 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLGTLDLHSNQLKEFPAGACKL

HMMPfam: PF13855
173-228 LRR_8,Leucine rich repeat

RLGTLDLHSNQLKEFPAGACKLRLSVLDLSNNTLSGLPPEIGTMTTLRKLLLSGNP

ProfileScan: PS51450
IPR001611
195-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLSVLDLSNNTLSGLPPEIGTM

HMMSmart: SM00369
IPR003591
195-214 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

RLSVLDLSNNTLSGLPPEIG

HMMSmart: SM00369
IPR003591
216-239 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTTLRKLLLSGNPMRTLRSSLVSG

ProfileScan: PS51450
IPR001611
218-239 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRKLLLSGNPMRTLRSSLVSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox