PRGDB00065659 (Afp.5389)

From PRG Wiki
Jump to: navigation, search
Afp.5389
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74561600 (DT759591)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1193440 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Y972, mRNA sequence

DNA Sequence

CGACTTGTCcgaaaaggaaacaaaaacataccgaaactatacggaaaaaaagaagaagAGGTTGGTATCTCACAGAGAAGGATAATGGGCTGCTTCGGTTGCTGCGAAGAAGATGATAATTACAAAGCTTCTGATAATCGAGTTCCAGTTATGGCGAATAATTCTGCAGGACATAATCATGCCACAGATACAGCACCTAAGGGTGCTCAGAGCGTAAAAGTTCAGCCTATAGCCGTTCCCTCCATTTCAGTAGATGAATTGAAGGAGGTAACAGATAACTTTGGGACAAAGGCTTTAGTTGGAGAGGGCTCATATGGAAGAGTATATTACGGTGTGATGAGAAATGGTTTGACTGCAGCAATAAAAAAGTTAGATGCTAGTAAGCAACCAGACCAAGAATTTTTAGCACAGGTCTCCATGGTATCAAGACTGAAACACGAAAATGTTGTTGAGCTGATTAGTTACTGTGTAGATGGAAACCTTCGTGTTCTTGCTTATGAGTTTGCTACAATGGGATCCCTTCATGACATTCTTCATGGGAGGAAAGGAGTTAAAGGAGCACAACCAGGTCCAGTTCTGTCATGGGCCCAACGAGTGAAAATTGCTGTAGGTGCAGCCAAAGGACTGGAATACTTGCATGAAAAGGCGCAGCCCCATGTAATCCATCGAGATATCAAGTCTAGCAATGTACTTCTTTTTGATGATGATGTTGCTAAAATTGCTGATTTTGACTTGTCAAATCAAGCTCCTGATATGGCAGCACGACTCCATTCCACTCGTGTTCTTGGGACATTTGGTTACCATGCTCCAGAATATGCAATGACTGGACAACTGAATTCTAAGAGTGATGTGTATAGCTTTGGGGTTGTGCTTTTGGAGCTCTTAACTGGCCG


Protein sequences

Name Description Sequence
Afp.5389 translated coding region predicted by ESTScan from UniGene Afp.5389

RLVRKGNKNIPKLYGKKEEEVGISQRRIMGCFGCCEEDDNYKASDNRVPVMANNSAGHNHATDTAPKGAQSVKVQPIAVPSISVDELKEVTDNFGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF870
66-298 SUBFAMILY NOT NAMED

PKGAQSVKVQPIAVPSISVDELKEVTDNFGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

HMMPanther: PTHR24420
66-298 FAMILY NOT NAMED,FAMILY NOT NAMED

PKGAQSVKVQPIAVPSISVDELKEVTDNFGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

superfamily: SSF56112
IPR011009
66-298 Protein kinase-like (PK-like)
Protein kinase-like domain

PKGAQSVKVQPIAVPSISVDELKEVTDNFGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

Gene3D: G3DSA:3.30.200.20
79-154 no description

VPSISVDELKEVTDNFGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELIS

ProfileScan: PS50011
IPR000719
94-298 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

HMMSmart: SM00220
IPR002290
94-298 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

HMMSmart: SM00219
IPR020635
94-298 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGTKALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

HMMPfam: PF07714
IPR001245
98-296 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ALVGEGSYGRVYYGVMRNGLTAAIKKLDASKQPDQEFLAQVSMVSRLKHENVVELISYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLT

PatternScan: PS00107
IPR017441
100-123 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGSYGRVYYGVMRNGLTAAIKK

Gene3D: G3DSA:1.10.510.10
155-298 no description

YCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNSKSDVYSFGVVLLELLTGR

PatternScan: PS00108
IPR008271
220-232 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox