PRGDB00065668 (Afp.6029)

From PRG Wiki
Jump to: navigation, search
Afp.6029
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74561208 (DT759365)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1193214 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Y838, mRNA sequence

DNA Sequence

TTCTTTTGAATACAAGACATAAATTGAGTTTAAGGAGTGCAAATAATAACAAGAGAGGGGATTACAAACAAAGAATTTATAAGTTAGTGTTCGGGTCCTGCTGGTCTTGAGGTAAGAAGTGGTTGAATAGCCTTGACAACGATGGTCATGTTTGGCCTGAAGTCTGCTTCATATTGAACGCACAAAGCTGCTACAGCTGCCAACTTTGCAATAGCCTTCGGCGGGTAGTCGTTGTTTAGCTTGGGATCTATGCACTGCTTAACTTTATCTTCACTCAACCTTGGAGTTGCCCAAGTAACAAGATTCTGTTGTCCTTTAGGCATTGTGTGATCTACTGGCTTCCTCCCCGTTAAAAGTTCTAGAAGAACAACACCAAAACTGTAGACATCACTTTTTTGTGTCAAAAATCCTGTCATTGCATACTCTGGAGCATGATATCCAAAAGTTCCTAACACTCGAGTCGAATGCAAGCGTGCTGCTGTATCTGGGGACTGGTTTGTCAGATTGAAATCGGCTATCTTTGCTGCAAAGTCATCAAATACGAGAACATTGCTGGATCTAACATCCCGATGAACTATACCAGGTTGAACCATTTCATGAAGATACTCAAGCCCTCTTGCTGCACCATAAGCAATTTTGACTCTTTGATTCCAGGTGAGAACAGGGCCAGGTTCAGCCCCTTGTGCTCCCTTCCTTCCATGTAGAATGTCATGTAAAGAACCCATGGTTGCAAATTGATACACCAAGATTCGATTATTTGCCTCCAAACAGTAACCAATTAATTCCACAAAATGCTCCTGCTTAAGCCTAGAAACTGTTGATAGCTGAGCTGCAAAATCAGAATCTGGCTCATTTGATGAACTGGGATCAAGCTTCTTTACAGCAGCAACCTGACCATCACTTAAAGTCGCGTAGAAAACCCGACCGTAAGACCCTTCTCCAACTAACGACTTTTGTCCGAAGTTATTA


Protein sequences

Name Description Sequence
Afp.6029 translated coding region predicted by ESTScan from UniGene Afp.6029

XNNFGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAIQPLLTSRPAGPEH

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-282 Protein kinase-like (PK-like)
Protein kinase-like domain

NNFGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAI

Gene3D: G3DSA:3.30.200.20
2-80 no description

NNFGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQF

HMMPanther: PTHR24420:SF816
3-294 SUBFAMILY NOT NAMED

NFGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAIQPLLTSRPAGPE

HMMPanther: PTHR24420
3-294 FAMILY NOT NAMED,FAMILY NOT NAMED

NFGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAIQPLLTSRPAGPE

ProfileScan: PS50011
IPR000719
4-286 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAIQPLL

HMMSmart: SM00220
IPR002290
4-286 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAIQPLL

HMMSmart: SM00219
IPR020635
4-282 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGQKSLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKAI

HMMPfam: PF07714
IPR001245
8-280 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLVGEGSYGRVFYATLSDGQVAAVKKLDPSSSNEPDSDFAAQLSTVSRLKQEHFVELIGYCLEANNRILVYQFATMGSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVK

PatternScan: PS00107
IPR017441
10-33 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGSYGRVFYATLSDGQVAAVKK

Gene3D: G3DSA:1.10.510.10
84-280 no description

GSLHDILHGRKGAQGAEPGPVLTWNQRVKIAYGAARGLEYLHEMVQPGIVHRDVRSSNVLVFDDFAAKIADFNLTNQSPDTAARLHSTRVLGTFGYHAPEYAMTGFLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQNLVTWATPRLSEDKVKQCIDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVK

PatternScan: PS00109
IPR008266
132-144 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDVRSSNVLV

Seg: seg
252-263 seg

KAIAKLAAVAAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox