PRGDB00065670 (Afp.6112)

From PRG Wiki
Jump to: navigation, search
Afp.6112
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74562049 (DT759844)
Gene Class Unknown
Domain Type LRR
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1193693 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YB20, mRNA sequence

DNA Sequence

CACTAAATATTGCAATATTACACATGCATTACACTGACACACATCAAGCTAGAGAACTTCAAGTTCGTAGCGTTTCCGAAACAGAAACAAAGATATCTCTATTACAGTATATCAACCGAAACGAAATCACTAATTAATGACACCTAGTAAGTGGTGAACCGCATAAACATGCATTATTAATGAAAGAAGAAGCTTCTAGATGATCAAATGGTGAACCAGCTGGAATTTGTCCACAAAGTTGATTATTCCTTAAATCCAAATGCCCGATATAAGCTGCAACCGATACAGATTTCGGTATCGGTCCTTTCAACTTGTTATAAGCAAGATCAAGTTCAGTGAAATAAGATCTCGGACCGAAAACATCTGGTATATATCCTTCAAGACTGTTTCGGCTCAAATTAAGAATACTTAAACCCGATCCACTCAATAAAGTCGATGGAATCGTACCTGTGATTCGATTATTGTCGAGATTTAAAGTGGAAAGTACCGGCATTTTACCAAGAGCAGCTGGAATAGTACCGGAAATTAAGTTTGAAGAGAGATCCAAATCGGCAAGTCGGTAAATTTTTGTGATTGAACTTGGAATCGTACCAGATAGCTGATTTCGACTCAGTAAAACTCGGCTTAGCATTTTTAAATTGCCGCACATTTGTGGAATCCCACCAATTAATCTGTTGTTTCTGAGATCAAGATGCATTAACTCAGCTAACTTCACAATCGACCCAGGAATTTTTCCGGTAATGAGATTATCGGCGACGTTAAACACGGTCATATGTTGAAGTCTTCCGATATCTGCCGGTATTGTGCCGGTGATTCTATTTCCGACAAGATCAAACACTCGTAGAAACTGGGAGTTTAGTAATGCATGTAGGAATTGTACCTGAAATACCCTTCCAATCTGCAATAATTACACTGGAAAGACGATCTAGTTTACAAATTGCCGGTGAGATGTAACCGGTCATGTAACCAGATCGGTGAGCTCTTT


Protein sequences

Name Description Sequence
Afp.6112 translated coding region predicted by ESTScan from UniGene Afp.6112

XRAHRSGYMTGYISPAICKLDRLSSVIIADWKGISGTIPTCITKLQFLRVFDLVGNRITGTIPADIGRLQHMTVFNVADNLITGKIPGSIVKLAELMHLDLRNNRLIGGIPQMCGNLKMLSRVLLSRNQLSGTIPSSITKIYRLADLDLSSNLISGTIPAALGKMPVLSTLNLDNNRITGTIPSTLLSGSGLSILNLSRNSLEGYIPDVFGPRSYFTELDLAYNKLKGPIPKSVSVAAYIGHLDLRNNQLCGQIPAGSPFDHLEASSFINNACLCGSPLTRCH


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
9-283 L domain-like,LRR

MTGYISPAICKLDRLSSVIIADWKGISGTIPTCITKLQFLRVFDLVGNRITGTIPADIGRLQHMTVFNVADNLITGKIPGSIVKLAELMHLDLRNNRLIGGIPQMCGNLKMLSRVLLSRNQLSGTIPSSITKIYRLADLDLSSNLISGTIPAALGKMPVLSTLNLDNNRITGTIPSTLLSGSGLSILNLSRNSLEGYIPDVFGPRSYFTELDLAYNKLKGPIPKSVSVAAYIGHLDLRNNQLCGQIPAGSPFDHLEASSFINNACLCGSPLTRCH

HMMPanther: PTHR24420:SF645
13-279 OS08G0505900 PROTEIN

ISPAICKLDRLSSVIIADWKGISGTIPTCITKLQFLRVFDLVGNRITGTIPADIGRLQHMTVFNVADNLITGKIPGSIVKLAELMHLDLRNNRLIGGIPQMCGNLKMLSRVLLSRNQLSGTIPSSITKIYRLADLDLSSNLISGTIPAALGKMPVLSTLNLDNNRITGTIPSTLLSGSGLSILNLSRNSLEGYIPDVFGPRSYFTELDLAYNKLKGPIPKSVSVAAYIGHLDLRNNQLCGQIPAGSPFDHLEASSFINNACLCGSPL

HMMPanther: PTHR24420
13-279 FAMILY NOT NAMED,FAMILY NOT NAMED

ISPAICKLDRLSSVIIADWKGISGTIPTCITKLQFLRVFDLVGNRITGTIPADIGRLQHMTVFNVADNLITGKIPGSIVKLAELMHLDLRNNRLIGGIPQMCGNLKMLSRVLLSRNQLSGTIPSSITKIYRLADLDLSSNLISGTIPAALGKMPVLSTLNLDNNRITGTIPSTLLSGSGLSILNLSRNSLEGYIPDVFGPRSYFTELDLAYNKLKGPIPKSVSVAAYIGHLDLRNNQLCGQIPAGSPFDHLEASSFINNACLCGSPL

Gene3D: G3DSA:3.80.10.10
31-279 no description

WKGISGTIPTCITKLQFLRVFDLVGNRITGTIPADIGRLQHMTVFNVADNLITGKIPGSIVKLAELMHLDLRNNRLIGGIPQMCGNLKMLSRVLLSRNQLSGTIPSSITKIYRLADLDLSSNLISGTIPAALGKMPVLSTLNLDNNRITGTIPSTLLSGSGLSILNLSRNSLEGYIPDVFGPRSYFTELDLAYNKLKGPIPKSVSVAAYIGHLDLRNNQLCGQIPAGSPFDHLEASSFINNACLCGSPL

HMMPfam: PF00560
IPR001611
48-69 LRR_1
Leucine-rich repeat

LRVFDLVGNRITGTIPADIGRL

HMMPfam: PF13855
143-202 LRR_8,Leucine rich repeat

RLADLDLSSNLISGTIPAALGKMPVLSTLNLDNNRITGTIPSTLLSGSGLSILNLSRNSL

Seg: seg
179-202 seg

TGTIPSTLLSGSGLSILNLSRNSL

HMMPfam: PF00560
IPR001611
242-260 LRR_1
Leucine-rich repeat

HLDLRNNQLCGQIPAGSPF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox