PRGDB00065674 (Afp.6321)

From PRG Wiki
Jump to: navigation, search
Afp.6321
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74554226 (DT755105)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1188954 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XI55, mRNA sequence

DNA Sequence

AAATGGCAGAAAAAATTACTGAAAATGGATCGAATATACTTCATGGGAAATATGAACTTGGTCGTATTCTTGGTCATGGTACTTTTGCAAAAGTTTACCATGCTAGGAATTTATCATCAGGGAAATCAGTAGCAATGAAAGTTGTTGGGAAAGAGAAAGTTATACAAGTTGGAATGATGGAACAAGTGAAAAGAGAAATCTCTGTAATGAAAATGGTAAAACATTCAAATATTGTTGAGCTTCACGAAGTTATGGCAAGTAAATCAAAGATATATTTTGCTATGGAATTTGTTCGTGGTGGTGAACTTTTTGCCAAAGTTGCTAAAGGTCGATTAAAGGAAGAAGTAGCTAGAGCTTATTTTCAACAGTTGATATCAGCAATTGATTTCTGTCACAGTCGTGGAGTTTATCATAGAGATTTAAAACCAGAAAATCTTCTTCTTGATGATGAAGGTAATCTTAAGGTAACTGATTTTGGTCTTAGTGCTTTATCTGAACATTTAAGACAAGATGGTTTATTACATACTACTTGTGGTACACCTGCTTATGTTGCTCCAGAAGTTATTGGAAAGAAAGGGTATTATGGTGCTAAAGCTGATCTTTGGTCTTGTGGGGTTATTTTATATGTTCTTTTAGCTGGATTTCTACCATTTCAAGATGATAATGTTGTTGCTATGTATAAGAAGATTTACAGGGGAGATTTCAAATGTCCTCCTTGGTTTTCTTCTGATGCAAGGCGACTTGTTACTAAGCTTCTTGATCCAAATCCTAGTTCTAGGATTACAATTTCAAAGGTAATGGAAACTTCTTGGTTTAAGAAATCAATCCCTAAAGCGATTTTGATTCAAGAAGCAAAGGAATTGGAAAGTGGTATGAATCAGTCTGAACTTAAAGTGAAGCAATCGGAGACATTGAATGCGTTTCATATTATTTCTTTATCCGAAGGGTTTGATTTGTCGCCTTTGTTTGAAG


Protein sequences

Name Description Sequence
Afp.6321 translated coding region predicted by ESTScan from UniGene Afp.6321

XMAEKITENGSNILHGKYELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWFKKSIPKAILIQEAKELESGMNQSELKVKQSETLNAFHIISLSEGFDLSPLFEX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
4-303 Protein kinase-like (PK-like)
Protein kinase-like domain

EKITENGSNILHGKYELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWFKKSIPKAILIQEAKELESGMNQSELKVKQSE

HMMPanther: PTHR24347:SF45
12-284 SUBFAMILY NOT NAMED,MYOSIN LIGHT CHAIN KINASE 3

NILHGKYELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWFKKSIPKAILIQE

HMMPanther: PTHR24347
IPR020636
12-284 FAMILY NOT NAMED
Calcium/calmodulin-dependent protein kinase-like

NILHGKYELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWFKKSIPKAILIQE

Gene3D: G3DSA:3.30.200.20
15-115 no description

HGKYELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEE

HMMPfam: PF00069
IPR017442
18-272 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWF

ProfileScan: PS50011
IPR000719
18-272 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWF

HMMSmart: SM00220
IPR002290
18-272 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWF

HMMSmart: SM00219
IPR020635
18-272 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRILGHGTFAKVYHARNLSSGKSVAMKVVGKEKVIQVGMMEQVKREISVMKMVKHSNIVELHEVMASKSKIYFAMEFVRGGELFAKVAKGRLKEEVARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWF

PatternScan: PS00107
IPR017441
24-51 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGTFAKVYHARNLSSGKSVAMKVVGK

Gene3D: G3DSA:1.10.510.10
116-293 no description

VARAYFQQLISAIDFCHSRGVYHRDLKPENLLLDDEGNLKVTDFGLSALSEHLRQDGLLHTTCGTPAYVAPEVIGKKGYYGAKADLWSCGVILYVLLAGFLPFQDDNVVAMYKKIYRGDFKCPPWFSSDARRLVTKLLDPNPSSRITISKVMETSWFKKSIPKAILIQEAKELESGMN

PatternScan: PS00108
IPR008271
136-148 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
300-324 NAF
NAF/FISL domain

KQSETLNAFHIISLSEGFDLSPLFE

HMMPfam: PF03822
IPR004041
302-324 NAF
NAF domain

SETLNAFHIISLSEGFDLSPLFE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox