PRGDB00065675 (Afp.6363)

From PRG Wiki
Jump to: navigation, search
Afp.6363
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 75452217 (DT763234)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1197083 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1YV30, mRNA sequence

DNA Sequence

TAATGTTGTACTTGTACAGTAGAAATTTACAACCCACATTGATGTATACATCAATGCCATTGGAGGAGAACTTAACTGGCATTGATTTTACAGTTTTCCTCGAGAATACAATTTCATTTATTGCAAGATTAAACAGAGGCATAGCTCGTAACAGGAGAGCCTATCAAGCCAGTACGAGTTGTTTGGAAAGACATATCAAAGGTGTCCCCTTCATAACCATCCACCGAACTCCTCTCGTTCAGAAGCTCTAGACATTGCACAATTTCAGACATTGTTGGTCTGAATTCTGGCTCAGTCTGTGTACAAAGAATGACAATATCAGCAAAACGGGAGAGGGACCTGGATGAGAACATTACTTTAGCTGTTGGATCAACCATCCCTTCTAGAGAGTCGTAGTCATGTAGACAGGATAAAGCCCACTTAACCAGAGATTGCTCTTGCCTTGGTTTTGAACTATCAAAAGGTTTCCTTCCTGTTAGTAGCTCCAAAAGCAACACACCAAAGGCATAGACATCGCTCTTCAATTTATCTATTCCCGGTTGGCTGTTTTCTGGAGCAGTGTAGCCTGTGCAACCAATAGCCAGTTCAGATGCCTTAACCTTGATGCTATTGCTCGTGAGGGGCCTGAGAACAGCTAGACCACAGTCACAGAGGCGAGGCATGAGCTCATCATCGAGTAAGATGTTAGCAGCCTTCAGATTGCAGTGAGCCACAGGGGGGAAGCACGCTGAGTGCAAATAGTCCAATGCCCGGGCCAAACCAAGAGCTATTCTTATGCGTGCAGTCCAGTTAAGATGCTTATGCGCATTGTGATGTAGTGCATTTTCAAGTGACCAATTTCTGACATACTGATACACAAGAAAGTGCTGCCCATGTTCCATACAGTAGCCAACAAGGGTTATAATATTAGATGTCTCAATCGCGCA


Protein sequences

Name Description Sequence
Afp.6363 translated coding region predicted by ESTScan from UniGene Afp.6363

CAIETSNIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELLNERSSVDGYEGDTFDMSFQTTRTGLIGSPVTSYASV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-229 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

CAIETSNIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELL

HMMSmart: SM00220
IPR002290
1-229 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

CAIETSNIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELL

HMMSmart: SM00219
IPR020635
1-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

CAIETSNIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCL

HMMPfam: PF07714
IPR001245
3-226 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

IETSNIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCL

Gene3D: G3DSA:1.10.510.10
4-232 no description

ETSNIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELLNER

superfamily: SSF56112
IPR011009
7-234 Protein kinase-like (PK-like)
Protein kinase-like domain

NIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELLNERSS

HMMPanther: PTHR24420:SF463
7-232 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELLNER

HMMPanther: PTHR24420
7-232 FAMILY NOT NAMED,FAMILY NOT NAMED

NIITLVGYCMEHGQHFLVYQYVRNWSLENALHHNAHKHLNWTARIRIALGLARALDYLHSACFPPVAHCNLKAANILLDDELMPRLCDCGLAVLRPLTSNSIKVKASELAIGCTGYTAPENSQPGIDKLKSDVYAFGVLLLELLTGRKPFDSSKPRQEQSLVKWALSCLHDYDSLEGMVDPTAKVMFSSRSLSRFADIVILCTQTEPEFRPTMSEIVQCLELLNER

Seg: seg
35-46 seg

NALHHNAHKHLN

Seg: seg
49-61 seg

ARIRIALGLARAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox