PRGDB00065676 (Afp.6401)

From PRG Wiki
Jump to: navigation, search
Afp.6401
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 71718670 (DR949307)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1140846 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1RG37, mRNA sequence

DNA Sequence

CTAAACTAAACTTAAGACAGTTCATCATTTAATCATActtcttcttcttcttcttcttcttTAGTTCTTTCCACCGTTTCTCTTTTATATTCATTAACCTACGCACTCTTTGTTTCTTATCCTGCGCATCTTAAATCGGTTTTATTCTTCTCAACATCTCTTTGACTAATTACTACTACAAAGATCTTTTCACTCTATCTCTCTTTTCTCGAAAGTGAATTGAAAAGAAGGAAAGTTTAAAGATAGATAGCCACTGAAGAAAAAGAATATGAGTTGCTTCAGCTGCTGTCCAGAAGATGATATCCATAGGGCTAATGTTAATGTAGGCCCATTCGTGGTGAACAATGCAGCAGGTAAACAGGGAGGATATCATGCCACAGATCCTGCAACTAAGGCTGCTCAGATAGTCAAAGTCCAACCTATTGCAGTTCCCCCTATTTCAGTTGAAGAACTGAAAGAAGTGACTGATAACTTTGGGACTAAGTCTCTAATTGGGGAGGGTTCATATGGCAGAGTATATTATGGAGTCTTGAAAAGTGGGCGGGCTGCAGCAATAAAAAAGTTAGATGCTAGTAAACAATCAGACCAAGAATTTACAGCACAGGTTTCCATGGTATCAAGACTGAAACATGAAAACGTTGTTGAGCTAGTTGGTTATTGTATAGATGGAAATCTCCGTGTCCTTGCTTATGAGTTTGCAACAATGGGATCTCTTCATGATATTCTTCATGGGAGGAAAGGTGTGAAAGGAGCACAACCTGGCCCAGTTCTTTCATGGGCTCAACGAGTTAAGATTGCTGTAGAGCAGCAAAGGACTTGAGTACTTGCACGAAAAGCACAGCCCATGTCATCCATCGTGACATCAGTCCAGCATGTGCTAATTTTGATGATGATGTATCTAAGTTGCAGACTTTGATTATCAAACGAAGCTCCTGACAATGCAGCACGTCTTCA


Protein sequences

Name Description Sequence
Afp.6401 translated coding region predicted by ESTScan from UniGene Afp.6401

MSCFSCCPEDDIHRANVNVGPFVVNNAAGKQGGYHATDPATKAAQIVKVQPIAVPPISVEELKEVTDNFGTKSLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVGYCIDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVEQQRT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF870
38-178 SUBFAMILY NOT NAMED

DPATKAAQIVKVQPIAVPPISVEELKEVTDNFGTKSLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVGYCIDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAV

HMMPanther: PTHR24420
38-178 FAMILY NOT NAMED,FAMILY NOT NAMED

DPATKAAQIVKVQPIAVPPISVEELKEVTDNFGTKSLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVGYCIDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAV

Gene3D: G3DSA:3.30.200.20
54-129 no description

VPPISVEELKEVTDNFGTKSLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVG

superfamily: SSF56112
IPR011009
58-179 Protein kinase-like (PK-like)
Protein kinase-like domain

SVEELKEVTDNFGTKSLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVGYCIDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVE

ProfileScan: PS50011
IPR000719
69-183 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGTKSLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVGYCIDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVEQQRT

HMMPfam: PF07714
IPR001245
73-156 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLIGEGSYGRVYYGVLKSGRAAAIKKLDASKQSDQEFTAQVSMVSRLKHENVVELVGYCIDGNLRVLAYEFATMGSLHDILHGR

PatternScan: PS00107
IPR017441
75-98 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYGVLKSGRAAAIKK

Gene3D: G3DSA:1.10.510.10
130-177 no description

YCIDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox