PRGDB00065690 (Afp.7085)

From PRG Wiki
Jump to: navigation, search
Afp.7085
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 74558034 (DT757504)
Gene Class Unknown
Domain Type
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1191353 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1XX45, mRNA sequence

DNA Sequence

GAAATTTAAATACAAGAGTTCGCATGAAGCAGTTTGAGTGGGAGTATGTAAGCATCACACGAGTGCGAAGGGGCAGGACATTATCCTTTTTACAAAAGTATTCAAGACCATCCATTACACACATGGATATTAAATCCTCGAGGGGATCATAGGAATGTTGTTTTGCAGATATGCACAAGCTGCTGCAACTCCGCTTCCCAATTTTACAGGGTATCCTACATCCTTGAGTATCATTTCGACGCCAGCCAGACAACCCAACAATTGCAACTCATTAAGGTTACCAAGATGCCCTATTCTGAACACCTTTCCAGCTACTTTATTCAATCCCAGACCCAAGCTTAAGTTGTACCTCTGCCATGCCCTTCTAACAATTTCTGCACTGTCAAGATAAGGTGGAACAACCACTGCAGTGACAGTGTCACTAAACCATTCCTCTTTCTGGGTACAATTTTTCAAACCCCATGCATCAACAGCAAGCCTAGTCGCAGTGCCTAAACGATTGTGCCTTGCAATCACATTATCAAGTCCTTCCTCAAATATGAGATCTAGAGCTGCCCTCAGGCCATACAAAAGTTGGATGGAGGGAGTGTATGGCCAATATGTTCCTATTTTGTAGAACTTTAAGTAGTCATTCCAGTCAAAGAATACTCTTACTGATTTGGCAGTCTTGGATGCTTCAAGTGCTTTGGGGCTAGCACACACAATACCCATTCCAGTAGGGAGGGAAAGAGCTTTTTGAGAGCCTGTTAAAGCAACATCTATTCCCCACTCGTCCATACGGAAATCAAGAGCACATATAGAGGACACTCCATCAACCAAAAACAGGGCACGATGGCCGTAGTGATCCAGAATCTTCCTTACAGCGGCCAAATTATTGGTACACCAGTAGCTGTTTCATTGTGACATGCAGACAGCCTTATGGTATGTGCTGTGTCTCAGCTATTCGATGCAGATATCAGATGCACTGGCCCAGTCACTTCACACATCACATGACT


Protein sequences

Name Description Sequence
Afp.7085 translated coding region predicted by ESTScan from UniGene Afp.7085

SHVMCEVTGPVHLISASNSXDTAHTIRLSACHNETATGXTNNLAAVRKILDHYGHRALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKIGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGTATRLAVDAWGLKNCTQKEEWFSDTVTAVVVPPYLDSAEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
25-264 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

TIRLSACHNETATGXTNNLAAVRKILDHYGHRALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKIGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGTATRLAVDAWGLKNCTQKEEWFSDTVTAVVVPPYLDSAEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPV

HMMPfam: PF00266
IPR000192
25-211 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

TIRLSACHNETATGXTNNLAAVRKILDHYGHRALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKIGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGTATRLAVDAWGLKNCTQKEEWFSDTVTAVVVPPYLDSAEIVR

Gene3D: G3DSA:3.40.640.10
IPR015421
25-144 no description
Pyridoxal phosphate-dependent transferase, major r

TIRLSACHNETATGXTNNLAAVRKILDHYGHRALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKIGTYWPYTPSIQLLY

HMMPanther: PTHR21152:SF7
32-288 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HNETATGXTNNLAAVRKILDHYGHRALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKIGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGTATRLAVDAWGLKNCTQKEEWFSDTVTAVVVPPYLDSAEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI

HMMPanther: PTHR21152
32-288 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

HNETATGXTNNLAAVRKILDHYGHRALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKIGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGTATRLAVDAWGLKNCTQKEEWFSDTVTAVVVPPYLDSAEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI

PatternScan: PS00595
IPR020578
79-99 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

IDVALTGSQKALSLPTGMGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
145-270 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLIFEEGLDNVIARHNRLGTATRLAVDAWGLKNCTQKEEWFSDTVTAVVVPPYLDSAEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox