PRGDB00065706 (Afp.7560)

From PRG Wiki
Jump to: navigation, search
Afp.7560
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 75454775 (DT764940)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Aquilegia formosa x Aquilegia pubescens

Comment?

EST1198789 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone CO1Z565, mRNA sequence

DNA Sequence

TTGACGactaaaatttagtcaaatacacacatacaacattacaaactaaaaaatgaataaaaactaaaGCTGCTGCAGTCATCCAACAATGACTACACTAGCAACCCAACAAGCTCCTTTTGATACAGCCTGAGATAAGATGTTGCCTTTCATTAAAATCATTATATGCAGTTCAGGGTAATAACCATCATGGGTCTTTATTTTATTGATTCCTGAAGTTGTTCCAATGCAGTTACTACCACATCCATATTTGGCCTCAACTTTGCTTTGTTTGCTAGACATTGGACCGCGAGGTGAACTACCTTTTGAGCCTTTTCCAGTGAATATTGACCGTCAAGACGGCTGTCTACAAGACAGAAAATCCTTTGATTGTCGCTTAGGTAAAGCATGACCCAATCCACCAGGTTCTGTTGATTTGATGGCCACAGCATGTCCTTCGCTCTTCGACCAGATAGAATTTCTAGGAGAACTACTCCAAAACTGTAAACATCACTCTCGGCAGTCAAACGACCTGTAGCTATATACTCAGGGCAAGCATAGCCATAAGTCCCCATTACACTTGTATAGACATGGCTATTATCACCAGTAGGGCCATCCCTAGCTAACCCAAAGTCAGAAAGCTTTGCGTTGTAGTTCCAATCAAGAAGGATATTAGAATTTTGACAACCCCGATGTATAACATTGACTTCAGCACTGTGAAGAAAGGCAAGCGCCTTTGCAGCCCCTAGTGCAATCTTCATACGAATGCTCCAGGAAAGTTGGCAGTAAGAATTGCCTGCATCAACAGCATGTATTCATACCTAAATTAAGTAAAGAATGATTAAGATAATTCTGCGAAAACCTACTCCAAAAGAGATGATTGTCCAAGCTCCCTTCACGCATAAACTCATAGACTAGTACGCGTTCCTGATTGTCTAAGCAATACCCTAACAATTTCACTAGATTGAGATGATACAACT


Protein sequences

Name Description Sequence
Afp.7560 translated coding region predicted by ESTScan from UniGene Afp.7560

XLYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTALEQLQESIK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-252 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTALEQLQESI

HMMSmart: SM00219
IPR020635
1-245 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XLYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTAL

Gene3D: G3DSA:3.30.200.20
2-28 no description

LYHLNLVKLLGYCLDNQERVLVYEFMR

HMMPfam: PF07714
IPR001245
2-244 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTA

superfamily: SSF56112
IPR011009
2-250 Protein kinase-like (PK-like)
Protein kinase-like domain

LYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTALEQLQE

HMMPanther: PTHR24420:SF861
2-250 SUBFAMILY NOT NAMED

LYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTALEQLQE

HMMPanther: PTHR24420
2-250 FAMILY NOT NAMED,FAMILY NOT NAMED

LYHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTALEQLQE

HMMSmart: SM00220
IPR002290
3-248 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YHLNLVKLLGYCLDNQERVLVYEFMREGSLDNHLFWSRFSQNYLNHSLLNLGMKHAVDAGNSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTALEQL

Gene3D: G3DSA:1.10.510.10
63-244 no description

NSYCQLSWSIRMKIALGAAKALAFLHSAEVNVIHRGCQNSNILLDWNYNAKLSDFGLARDGPTGDNSHVYTSVMGTYGYACPEYIATGRLTAESDVYSFGVVLLEILSGRRAKDMLWPSNQQNLVDWVMLYLSDNQRIFCLVDSRLDGQYSLEKAQKVVHLAVQCLANKAKLRPNMDVVVTA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox