PRGDB00065776 (Ahy.7516)

From PRG Wiki
Jump to: navigation, search
Ahy.7516
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225609311 (GO337734)
Gene Class Unknown
Domain Type
Gene Species Arachis hypogaea

Comment?

VBL6_54_P15_E001.g1 Normalized cDNA library from developing embryos of peanut Arachis hypogaea cDNA, mRNA sequence

DNA Sequence

GACGATAAAGGAATTAAGAATGGAAGAAAGCAAAGGAAGAGTGCGTTTAAGAGGGGGAACAGGTTTCATTGGTTCATGGATAATCAAGAAGCTTCTTGAAGATGGTTACTCTGTTAATACAACTGTCAGATCAACCCCAGAACACAAGAAAGATGTTAGTTTCCTCACCAACTTACCCGGATCATCCCAGAGGCTTCGAATTCTCAGTGCCAATCTCAGCGAACCATCGAGTTTCAACGCAGCCATTGAAGGTTGCATTGGAGTTTTCCATGTTGCCACCCCATATGACTTTGAAGACAAAGAATCAGAACAAGTATTAACACAAAGATCCATTGATGGTGCACTAGGAATTTTGAAAGCGTGCCTAAATTCCAAGACTGTGAAGCGAGTTGTTTATACTTCAAGTGCCTCTGCTGTTGTTAGTTCCAATAACCAAGAACATAACGAGGCGTTGGACGAAAGTGTCTGGAGTGATGTCGATTTCATCAGAGCTTCGAAGGCTCCGGCTTCATCGTACGCAGTCTCGAAGACACTAACGGAGAAGGCATTGCTGAAATTCGGAGAAGAGAACGGATTGGAGGTTGTGACAATTGTCCCAACTTTTGTTTTTGGACCCTTCATTTGTCCTAAGCTTCTCGGCTCTGTTAATGCTTCATTGTCTATGGTATTTGGTGAAAAAACACTATTTGGTTTGATGCTTGAGATACCTATGGTGCATGT


Protein sequences

Name Description Sequence
Ahy.7516 translated coding region predicted by ESTScan from UniGene Ahy.7516

XTIKELRMEESKGRVRLRGGTGFIGSWIIKKLLEDGYSVNTTVRSTPEHKKDVSFLTNLPGSSQRLRILSANLSEPSSFNAAIEGCIGVFHVATPYDFEDKESEQVLTQRSIDGALGILKACLNSKTVKRVVYTSSASAVVSSNNQEHNEALDESVWSDVDFIRASKAPASSYAVSKTLTEKALLKFGEENGLEVVTIVPTFVFGPFICPKLLGSVNASLSMVFGEKTLFGLMLEIPMVHV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
2-241 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

TIKELRMEESKGRVRLRGGTGFIGSWIIKKLLEDGYSVNTTVRSTPEHKKDVSFLTNLPGSSQRLRILSANLSEPSSFNAAIEGCIGVFHVATPYDFEDKESEQVLTQRSIDGALGILKACLNSKTVKRVVYTSSASAVVSSNNQEHNEALDESVWSDVDFIRASKAPASSYAVSKTLTEKALLKFGEENGLEVVTIVPTFVFGPFICPKLLGSVNASLSMVFGEKTLFGLMLEIPMVHV

HMMPanther: PTHR10366
2-241 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

TIKELRMEESKGRVRLRGGTGFIGSWIIKKLLEDGYSVNTTVRSTPEHKKDVSFLTNLPGSSQRLRILSANLSEPSSFNAAIEGCIGVFHVATPYDFEDKESEQVLTQRSIDGALGILKACLNSKTVKRVVYTSSASAVVSSNNQEHNEALDESVWSDVDFIRASKAPASSYAVSKTLTEKALLKFGEENGLEVVTIVPTFVFGPFICPKLLGSVNASLSMVFGEKTLFGLMLEIPMVHV

superfamily: SSF51735
8-237 NAD(P)-binding Rossmann-fold domains

MEESKGRVRLRGGTGFIGSWIIKKLLEDGYSVNTTVRSTPEHKKDVSFLTNLPGSSQRLRILSANLSEPSSFNAAIEGCIGVFHVATPYDFEDKESEQVLTQRSIDGALGILKACLNSKTVKRVVYTSSASAVVSSNNQEHNEALDESVWSDVDFIRASKAPASSYAVSKTLTEKALLKFGEENGLEVVTIVPTFVFGPFICPKLLGSVNASLSMVFGEKTLFGLMLEIP

HMMPfam: PF01370
IPR001509
19-207 Epimerase
NAD-dependent epimerase/dehydratase

GGTGFIGSWIIKKLLEDGYSVNTTVRSTPEHKKDVSFLTNLPGSSQRLRILSANLSEPSSFNAAIEGCIGVFHVATPYDFEDKESEQVLTQRSIDGALGILKACLNSKTVKRVVYTSSASAVVSSNNQEHNEALDESVWSDVDFIRASKAPASSYAVSKTLTEKALLKFGEENGLEVVTIVPTFVFGPF

Gene3D: G3DSA:3.40.50.720
IPR016040
19-211 no description
NAD(P)-binding domain

GGTGFIGSWIIKKLLEDGYSVNTTVRSTPEHKKDVSFLTNLPGSSQRLRILSANLSEPSSFNAAIEGCIGVFHVATPYDFEDKESEQVLTQRSIDGALGILKACLNSKTVKRVVYTSSASAVVSSNNQEHNEALDESVWSDVDFIRASKAPASSYAVSKTLTEKALLKFGEENGLEVVTIVPTFVFGPFICPK

Seg: seg
135-145 seg

SSASAVVSSNN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox