PRGDB00065779 (Ahy.9112)

From PRG Wiki
Jump to: navigation, search
Ahy.9112
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 149644929 (ES753324)
Gene Class Unknown
Domain Type
Gene Species Arachis hypogaea

Comment?

C20L_26_E03_E002.g1 USDA-Tifton Peanut Library C20L Arachis hypogaea cDNA clone C20L-026_E03 5', mRNA sequence

DNA Sequence

TTTTGAAGGAAGAAGCCAAGAACGGCTTGAATTCTAAAGAAGGAAAAGATGGATTACGTTTACGCGCCAGGAAGAAACCATCTCTTTGTTCCAGGGCCTGTCAACATCCCTGAGCCGGTCATCCGGGCGATGAACCGAAACAACGAGGATTACCGTTCTCCGGCGATTCCTGCATTGACTAAAACCCTGCTTGAGGATGTCAAGAAGATTTTCAAGACTACTACTGGAGTCCCATTTCTCATCCCTACAACTGGTACCGGTGCATGGGAGAGTGCACTGACAAACACATTGTCTCCGGGGGATCGAATCGTATCATTCTTGATCGGGCAATTCAGCTTGCTGTGGATTGATCAGCAACAACGCCTCAACTTCGATGTTGATGTTGTCGAAAGCGAATGGGGCCAGGGTGCAAATCTTGATGTTCTGGAATCAAAGCTTGCTTCGGATACTTCTCACACTATAAAGGCAATTTGCATTGTCCACAATGAAACTGCAACTGGTGTCACCAATAACTTGGCCAAAGTTAGACAACTTCTTGATGACTACCAGCATCCAGCTCTGTTCCTTGTGGATGGAGTTTCTTCGATTTGTGCACTCGATTTCCGCATGGACGAATGGGGAATTGATGTGGCCTTGACTGGCTCCCAGAAAGCTCTTTCGCTTCCCACAGGGATGGGTATTGTGTGTGCAAGCCCCAAAGCACTTGAGGCTTCAAAGACTGCTAAATCAGTGAGAGTTTTCTTTGATTGGAAGGACTACTTGAAATTCTATCAGATGGGAACTTATTGGCCATACACTC


Protein sequences

Name Description Sequence
Ahy.9112 translated coding region predicted by ESTScan from UniGene Ahy.9112

MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGVPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFDVDVVESEWGQGANLDVLESKLASDTSHTIKAICIVHNETATGVTNNLAKVRQLLDDYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYQMGTYWPYTX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-250 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGVPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFDVDVVESEWGQGANLDVLESKLASDTSHTIKAICIVHNETATGVTNNLAKVRQLLDDYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYQMGTYWPYT

HMMPanther: PTHR21152
1-250 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGVPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFDVDVVESEWGQGANLDVLESKLASDTSHTIKAICIVHNETATGVTNNLAKVRQLLDDYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYQMGTYWPYT

superfamily: SSF53383
IPR015424
7-250 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGVPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFDVDVVESEWGQGANLDVLESKLASDTSHTIKAICIVHNETATGVTNNLAKVRQLLDDYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYQMGTYWPYT

HMMPfam: PF00266
IPR000192
12-226 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGVPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFDVDVVESEWGQGANLDVLESKLASDTSHTIKAICIVHNETATGVTNNLAKVRQLLDDYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAK

Gene3D: G3DSA:3.40.640.10
IPR015421
21-250 no description
Pyridoxal phosphate-dependent transferase, major r

PEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGVPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFDVDVVESEWGQGANLDVLESKLASDTSHTIKAICIVHNETATGVTNNLAKVRQLLDDYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYQMGTYWPYT

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

IDVALTGSQKALSLPTGMGIV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox