PRGDB00065780 (Ahy.9200)

From PRG Wiki
Jump to: navigation, search
Ahy.9200
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 149644396 (ES752791)
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Arachis hypogaea

Comment?

C20L_18_A01_E002.g1 USDA-Tifton Peanut Library C20L Arachis hypogaea cDNA clone C20L-017-1_A01 5', mRNA sequence

DNA Sequence

TGCTTCTTCTTCTTGGTGCATGTCCTGAGCATGGATGCCTTGTGTATGAATATATGGAGAATGGTAACTTGGACGATAGATTACTCCGGAAAAACAATGCGACCCCTATTCCATGGTTTGAGAGGTATCGAATAGCATGGGAAGTTGCATCAGCTCTATCCTTTCTTCACAGTTCGAAGCCAAAACCAATCATCCATCGTGATTTGAAGCCAGCGAACATCCTTCTTGGTCGTAACCTTGTCAGCAAGATTGGTGATATTGGCCTTTCGACAATGCTTCAGTCAGATAATTTATCCACCATGTACAAGGACACTGAGCCTGTTGGGACACTCTGCTACATAGACCCTGAGTATCAAAGAAATGGATTGATATCACCAAAATCAGATGTTTATGCTTTGGGAATAGTTATATTACAGTTATTGACTGCAAAACCAGCCATAGGAATTACTCATGTGGTTGAAACAGCAATTGGTGCCGGGAAGTTGACGGATATATTGGATCCAGAGGCAGGAAGTTGGCCATTTCAAGAGACATTAGAATTAGCTCAATTAGGACTGAGCTGTGCTGAACTTCGGCGAATAGACCGGCCTGATTTGAAAGATCAAGTTCTTCCTACACTAGAGAGATTGAAAGAAATTGCTGATAGGACTCAACAATCTCCTTCAATAGTATTTGTTAGATCCAGACCTCCCAATCACTTTATCTGTCCAATACTTCAGGATGTGATGGATGATCCTTGTGTTGCTGCGGATGGATATTCATATGATCGTAAAGCAATTGAAAAGTGGTTTCAAGAGAATGACAAATCACCAATGACAAATATGGCCTTACCAC


Protein sequences

Name Description Sequence
Ahy.9200 translated coding region predicted by ESTScan from UniGene Ahy.9200

XLLLLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTLERLKEIADRTQQSPSIVFVRSRPPNHFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNMALPX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-207 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLLLLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTL

HMMPanther: PTHR24420:SF447
2-275 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LLLLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTLERLKEIADRTQQSPSIVFVRSRPPNHFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNM

HMMPanther: PTHR24420
2-275 FAMILY NOT NAMED,FAMILY NOT NAMED

LLLLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTLERLKEIADRTQQSPSIVFVRSRPPNHFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNM

HMMSmart: SM00219
IPR020635
3-210 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LLLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTLERL

superfamily: SSF56112
IPR011009
4-229 Protein kinase-like (PK-like)
Protein kinase-like domain

LLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTLERLKEIADRTQQSPSIVFVRSR

HMMSmart: SM00220
IPR002290
4-207 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LLGACPEHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKDQVLPTL

HMMPfam: PF00069
IPR017442
10-147 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EHGCLVYEYMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAI

Gene3D: G3DSA:1.10.510.10
18-201 no description

YMENGNLDDRLLRKNNATPIPWFERYRIAWEVASALSFLHSSKPKPIIHRDLKPANILLGRNLVSKIGDIGLSTMLQSDNLSTMYKDTEPVGTLCYIDPEYQRNGLISPKSDVYALGIVILQLLTAKPAIGITHVVETAIGAGKLTDILDPEAGSWPFQETLELAQLGLSCAELRRIDRPDLKD

PatternScan: PS00108
IPR008271
64-76 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPANILL

superfamily: SSF57850
229-277 RING/U-box,NBS

RPPNHFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNMAL

HMMPfam: PF04564
IPR003613
231-278 U-box
U box domain

PNHFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNMALP

Gene3D: G3DSA:3.30.40.10
IPR013083
231-277 no description
Zinc finger, RING/FYVE/PHD-type

PNHFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNMAL

HMMSmart: SM00504
IPR003613
233-279 Modified RING finger domain
U box domain

HFICPILQDVMDDPCVAADGYSYDRKAIEKWFQENDKSPMTNMALPX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox