PRGDB00065842 (At.302)

From PRG Wiki
Jump to: navigation, search
At.302
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 15027840 (AY045777)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At1g65800 mRNA sequence

DNA Sequence

AAAAACAGAACACAAGAAAGTGTCCTAGCTagagagagagagagagaTGAGAAATGTACCAAACTATCATCATTCTTACTTCATATTATTCATCATAATTCTGTTTCTTGCTTTCTCTGTTTATGCAAGCAACTTTTCAGCCACAGAATCTCTCACTATCTCAAGCAACAAAACCATTATATCTCCTAGTCAAATCTTCGAGCTCGGTTTCTTCAATCCCGACTCAAGTTCACGTTGGTATCTCGGCATATGGTACAAGATAATCCCTATAAGAACCTACGTATGGGTTGCAAACAGAGACAATCCTCTCTCTAGTTCCAACGGAACTCTCAAAATATCCGACAATAACCTCGTCATTTTCGATCAGTCCGATAGGCCTGTTTGGTCGACGAATATAACCGGAGGAGATGTGAGATCACCAGTGGCTGCAGAGCTTCTTGATTACGGTAATTTTGTTCTTAGAGACTCCAAAAATAATAAACCAAGTGGATTTTTGTGGCAGAGTTTCGATTTCCCGACAGATACTTTACTATCGGATATGAAAATGGGATGGGATAACAAAAGCGGAGGATTCAACAGAATCTTGAGATCTTGGAAAACCACAGATGATCCGTCAAGCGGAGATTTCTCGACTAAACTCCGAACCAGCGGGTTCCCGGAGTTTTACATATACAACAAAGAGTCCATAACGTACAGGAGCGGTCCATGGCTCGGAAATCGGTTTAGCAGCGTACCGGGGATGAAACCAGTTGATTACATAGACAACAGTTTCACAGAGAATAATCAACAAGTTGTTTACTCATACCGAGTCAACAAAACCAACATTTACTCGATATTAAGCCTAAGCTCCACGGGACTATTACAACGATTAACTTGGATGGAGGCAGCACAGAGTTGGAAACAGTTATGGTACTCACCAAAGGACCTATGTGATAACTACAAAGAGTGTGGGAATTACGGTTATTGCGATGCGAACACTTCACCTATTTGTAATTGTATCAAAGGGTTTGAGCCAATGAATGAGCAAGCGGCTTTGAGAGATGATTCTGTTGGTTGCGTGAGGAAGACGAAGCTAAGCTGTGACGGTAGAGATGGGTTTGTGCGGTTGAAGAAGATGAGACTGCCAGATACTACAGAGACAAGTGTGGACAAAGGAATTGGGTTGAAAGAATGTGAAGAGAGGTGCCTAAAGGGTTGTAATTGTACGGCGTTTGCTAATACGGATATTCGTAATGGCGGTTCAGGTTGTGTGATTTGGTCCGGAGGGCTGTTCGATATCCGAAATTATGCTAAGGGAGGTCAGGATCTTTACGTTAGAGTAGCTGCTGGTGATCTAGAGGACAAGAGAATCaaaagtaaaaaaaTCATAGGTTCGAGTATTGGAGTGAGCATTTTGCTTCTTTTAAGTTTCATCATCTTCCATTTTTGGAAAAGGAAGCAGAAGCGATCAATAACAATTCAAACACCTATTGTTGATCTTGTGAGAAGCCAAGATTCTCTAATGAACGAATTGGTAAAAGCAAGCAGGAGTTACACATCCAAAGAAAACAAAACCGATTATCTAGAGCTCCCATTGATGGAGTGGAAAGCTTTAGCCATGGCAACAAACAATTTTTCGACGGACAATAAGCTTGGACAAGGTGGTTTTGGTATTGTTTACAAGGGAATGTTACTTGATGGAAAAGAAATCGCGGTAAAGAGACTATCGAAAATGTCTTCACAAGGGACCGATGAGTTCATGAACGAGGTTAGATTAATTGCAAAGCTTCAGCACATAAACCTTGTCCGGCTTCTAGGTTGTTGCGTCGATAAGGGTGAGAAGATGTTGATCTATGAGTACTTGAGAATCTAAGCCTTGACTCGCATCTCTTTGACCAAACACGAAGCTCTAACTTAAATTGGCAAAAGAGATTTGATATTATCAATGGTATTGCTAGAGGACTTCTATATCTTCACCAAGATTCACGGTGTAGGATTATCCATAGAGACTTGAAAGCAAGTAACGTATTGCTTGATAAAAATATGACTCCAAAGATCTCCGATTTTGGGATGGCGAGGATCTTTGGACGGGAGGAGACAGAGGCTAATACAAGGAGGGTGGTCGGAACTTACGGCTACATGTCTCCAGAATATGCAATGGACGGGATATTCTCGATGAAGTCGGATGTTTTCAGCTTTGGGGTCTTGCTTCTAGAGATTATAAGTGGAAAAAGAAACAAAGGATTCTACAACTCAAACCGTGATCTTAATCTCCTTGGTTTTGTGTGGAGGCATTGGAAGGAAGGAAAAGAGCTAGAGATTGTAGATCCGATCAACATCGATGCTTTGTCATCAGAATTCCCGACACATGAAATCTTAAGATGTATACAAATTGGTCTCTTGTGTGTTCAAGAACGAGCCGAAGACAGACCAGTGATGTCCTCGGTAATGGTGATGCTTGGAAGCGAAACTACGGCTATTCCTCAGCCTAAACGTCCTGGTTTTTGCGTGGGGAGAAGTTCTCTTGAGGTTGATTCTTCGTCAAGTACACAGCGAGACGATGAATGTACAGTGAACCAAGTCACTCTCTCGGTCATTGACGCTCGGTAATATGTAAGATTGTAAGTTATCGACCCACTCTTTTTATATAAAAATATAGACACAGGGCAGTAAGGTCTCCACACTAGGGGCTGATACTTTGCATCAGTCAGTGATACCTTGTGTAACAAGTTTCCTTTGCCTCCATGGAACGTATACAAAAGTTGTATTCAACTTCGTTGTAAATATAATTAAGATaaaaagaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.302 translated coding region predicted by ESTScan from UniGene At.302

XKTEHKKVSXLEREREMRNVPNYHHSYFILFIIILFLAFSVYASNFSATESLTISSNKTIISPSQIFELGFFNPDSSSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESITYRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQRLTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMNEQAALRDDSVGCVRKTKLSCDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDIRNYAKGGQDLYVRVAAGDLEDKRIKSKKIIGSSIGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDLVRSQDSLMNELVKASRSYTSKENKTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF432
10-863 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

XLEREREMRNVPNYHHSYFILFIIILFLAFSVYASNFSATESLTISSNKTIISPSQIFELGFFNPDSSSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESITYRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQRLTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMNEQAALRDDSVGCVRKTKLSCDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDIRNYAKGGQDLYVRVAAGDLEDKRIKSKKIIGSSIGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDLVRSQDSLMNELVKASRSYTSKENKTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR

HMMPanther: PTHR24420
10-863 FAMILY NOT NAMED,FAMILY NOT NAMED

XLEREREMRNVPNYHHSYFILFIIILFLAFSVYASNFSATESLTISSNKTIISPSQIFELGFFNPDSSSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESITYRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQRLTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMNEQAALRDDSVGCVRKTKLSCDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDIRNYAKGGQDLYVRVAAGDLEDKRIKSKKIIGSSIGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDLVRSQDSLMNELVKASRSYTSKENKTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR

Seg: seg
28-37 seg

FILFIIILFL

ProfileScan: PS50927
IPR001480
45-167 BULB_LECTIN
Bulb-type lectin domain

NFSATESLTISSNKTIISPSQIFELGFFNPDSSSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLW

HMMSmart: SM00108
IPR001480
51-173 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SLTISSNKTIISPSQIFELGFFNPDSSSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFP

superfamily: SSF51110
IPR001480
76-239 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

SSSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESITYRSGPWLG

HMMPfam: PF01453
IPR001480
92-206 B_lectin
Bulb-type lectin domain

RTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
207-243 no description
Bulb-type lectin domain

SGDFSTKLRTSGFPEFYIYNKESITYRSGPWLGNRFS

HMMPfam: PF00954
IPR000858
232-341 S_locus_glycop
S-locus glycoprotein

YRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQRLTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMN

HMMPfam: PF08276
IPR013227
361-427 PAN_2
PAN-2 domain

CDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDI

ProfileScan: PS50948
IPR003609
361-442 PAN
Apple-like

CDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDIRNYAKGGQDLYVRVA

HMMSmart: SM00473
IPR003609
362-441 divergent subfamily of APPLE domains
Apple-like

DGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDIRNYAKGGQDLYVRV

Seg: seg
451-474 seg

IKSKKIIGSSIGVSILLLLSFIIF

HMMPfam: PF12398
IPR022126
488-529 DUF3660
S-locus, receptor kinase

QTPIVDLVRSQDSLMNELVKASRSYTSKENKTDYLELPLMEW

superfamily: SSF56112
IPR011009
525-845 Protein kinase-like (PK-like)
Protein kinase-like domain

PLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCVGRSSLEVDSSSSTQ

Gene3D: G3DSA:3.30.200.20
526-613 no description

LMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYE

ProfileScan: PS50011
IPR000719
539-829 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGF

HMMSmart: SM00219
IPR020635
539-814 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVML

HMMSmart: SM00220
IPR002290
539-812 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMV

HMMPfam: PF07714
IPR001245
541-812 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

TDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEXLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMV

PatternScan: PS00107
IPR017441
545-567 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGIVYKGMLLDGKEIAVK

Gene3D: G3DSA:1.10.510.10
616-814 no description

ENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVML

PatternScan: PS00108
IPR008271
660-672 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL

HMMPfam: PF11883
IPR021820
816-863 DUF3403
S-locus receptor kinase, C-terminal

SETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox