PRGDB00065843 (At.318)

From PRG Wiki
Jump to: navigation, search
At.318
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 20856746 (AY102113)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT5g60900

DNA Sequence

CTTGTTTGATAATCCATCTTTTACGTTTACAATCAGAAATATCTAAAGACAAAACACACACAACCACAATGTAGTCTATTTGTTCCTACCCTTAAAAGTCTCTGTTGGCTTTTCAAAACCTGGTCCATTGAGTCATTGACTCAGAGAGTTAGAACTAAAAAGTCTTTATATTTACACATATACGCAGATTTAATCTCTACATCTTTGCTTCAGTAAAATGGGTTCTCTTTCTTGTTCAATAATCCATCTGGTTCTTATTCTGCAACTACAAACAtttttcgttttttCTCAAAACATCAGAAACGGCTCTGTTCCTGTCGGAGAATCTCTCACCGCTTCAGAGTCCCAACAAATCTCTAGTTCATGGCGTTCACCTTCCGGTGACTTTGCTTTCGGGTTCCGCAAGATCCAACCAAACGACGGTTTCACTCTCTCCATTTGGTTCGACAAGATTTCTGACAAGACCATCGTGTGGCACGCACAAGCCGTCAACACAACCACCGGTCTTGTCCCTAATGGTTCGAAGGTTACATTAACTGCAGATGGCGGTCTGGTTATCGCTGACCCTCGAGGTCAGGAGCTGTGGAGAGCGTTGAGTGGTGGCTCTGTTTCTCGAGGGCGATTTACTGACGACGGAAACTTCGTTCTTTTCAGAGATGGGTCAGAAGATTCTGACGAGGTTCTATGGTCGAGCTTTGAAAATCCCACCGACACTCTGTTACCTAATCAGAATATAGAAGTTGGAAGGAATCTGTCATCACGTAGGACAGAGACGAGCTTCAAAAAAGGAAGATTCAGCCTACGTCTAGAGGATGACGGAAATCTTCAGCTTCACTCTCTCAACGCCGAGACTGCCTCAGAATCAGACATATACTCTCAGTACTACGAAAGTAATACCAACGATCCAAACAACCCCGGGATTCAATTAGTTTTCAACCAGTCAGGGGAAATATATGTTCTTCAAAGGAACAATTCAAGATTCGTCGTCAAAGATAGAGATCCGGATTTTTCTATCGCCGCGCCGTTCTACATTTCGACGGGGTTTTTGCTGAGTACTATCATCCCAAAGGAGGCCAGGAGAATAGTGGGTGGGTGTTTGCTTGGGCTGTGCCGGATAATATGTGTAGCCCCGATGATGCACTTGGGAATATGGCTTGTGGGTATAATAATATATGTAGTTTAGGAAACAACAAGAGGCCAAAATGTGAGTGTCCTGAGAGGTTTGTGTTAAAGGATCCGAGCAATGAGTATGGTGATTGTTTGCCAGATTTTGAGATGCAGACTTGTAGACCAGAGAACCAAACCGCAAACTCAGATGTGAATCTTTACGAGTTCATTACTTTAGAGAAGACGAATTGGCCGTTTGGGGATTATGAGAGTTATGCCAACTATGATGAAGAAAGATGTAAAGCTTCTTGTCTTAGCGATTGTTTATGTGCTGCGGTTATTTTTGGAACAAATCGGGATCTAAAATGTTGGAAGAAGAAGTTTCCCTTGTCTCACGGTGAAAGATCTCCACGTGGTGATAGTGATACATTCATTAAGGTTCGAAACCGCTCCATCGCGGATGTTCCAGTTACCGGAAACAGAGCGAAAAAACTTGACTGGTTAATCATTGCTTGTTCTGTTCTACTTGGAACTTCAGCTTTTGTGATTTTTGATACTTCTTGCTCTTTATAGAAAGACTAAGAAGAGTAAAAATATGATGAAGAATCAAGCGAGAGATATCGGTCGGACTACAGCTACAACTACTGCAAATGAGTTGAATTTGAGGGTCTTTACATATGGAGAGCTTGCAGAGGCTACAAGAGATTTCACGGAAGAGCTTGGAAGAGGAGCCTTTGGTATAGTTTACAAAGGATATTTAGAAGTTGCCGGTGGTTCTGAAGTTACCGTGGCTGTGAAGAAACTAGATCGTCTTGATTTAGATAACGAAAAAGAGTTCAAGAATGAGGTTAAAGTGATAGGTCAGATTCACCACAAGAACCTAGTGAGGCTCATTGGCTTCTGCAACGAAGGACAGAGCCAGATGATCGTCTATGAGTTTTTACCACAAGGGACGCTAGCCAATTTTCTCTTCAGGCGTCCGAGGCCGAGCTGGGAAGATAGAAAGAATATTGCGGTGGCCATTGCTCGTGGAATCTTGTATCTACATGAAGAGTGCAGCGAGCAGATCATACACTGTGACATAAAACCGCAGAACATACTCCTAGATGAGTATTACACTCCTCGGATCTCGGATTTTGGTCTAGCAAAGCTTTTGTTGATGAACCAAACGTATACGCTCACTAACATCCGTGGAACAAAAGGGTATGTGGCCCCTGAATGGTTCAGGAATAGCCCCATTACATCCAAAGTAGATGTTTATAGCTATGGAGTAATGCTTTTAGAAATCGTGTGCTGCAAGAAAGCCGTCGACCTTGAGGATAACGTGATTCTCATCAATTGGGCTTACGATTGTTTTCGACAAGGAAGGTTGGAAGATCTGACTGAGGACGATTCAGAGGCAATGAATGACATGGAAACTGTGGAGAGATATGTGAAAATAGCGATATGGTGTATACAAGAAGAGCATGGGATGAGACCTAACATGAGAAATGTTACACAGATGCTTGAAGGTGTGATTCAAGTTTTTGATCCTCCAAATCCGTCTCCTTATAGCACTTTCACTTGGTCTGATGAATCTTTGTCTAGTGATCCAGTGTCACTTGTTTGATAAGTTGATaaaaaaacaaaaTAAAGTTATTATACTTTTGTATGGAATAAACTCCAATCATTAATATTACGTTAAATAATCACACCTTTTTTT


Protein sequences

Name Description Sequence
At.318 translated coding region predicted by ESTScan from UniGene At.318

MGSLSCSIIHLVLILQLQTFFVFSQNIRNGSVPVGESLTASESQQISSSWRSPSGDFAFGFRKIQPNDGFTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENPTDTLLPNQNIEVGRNLSSRRTETSFKKGRFSLRLEDDGNLQLHSLNAETASESDIYSQYYESNTNDPNNPGIQLVFNQSGEIYVLQRNNSRFVVKDRDPDFSIAXAVLHFDGVFAEYYHPKGGQENSGWVFAWAVPDNMCSPDDALGNMACGYNNICSLGNNKRPKCECPERFVLKDPSNEYGDCLPDFEMQTCRPENQTANSDVNLYEFITLEKTNWPFGDYESYANYDEERCKASCLSDCLCAAVIFGTNRDLKCWKKKFPLSHGERSPRGDSDTFIKVRNRSIADVPVTGNRAKKLDWLIIACSVLLGTSAFVIFDLLALYRKTKKSKNMMKNQARDIGRTTATTTANELNLRVFTYGELAEATRDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQMLEGVIQVFDPPNPSPYSTFTWSDESLSSDPVSLV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF815
1-822 RLK1 (RECEPTOR-LIKE PROTEIN KINASE 1); CARBOHYDRATE BINDING / KINASE

MGSLSCSIIHLVLILQLQTFFVFSQNIRNGSVPVGESLTASESQQISSSWRSPSGDFAFGFRKIQPNDGFTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENPTDTLLPNQNIEVGRNLSSRRTETSFKKGRFSLRLEDDGNLQLHSLNAETASESDIYSQYYESNTNDPNNPGIQLVFNQSGEIYVLQRNNSRFVVKDRDPDFSIAXAVLHFDGVFAEYYHPKGGQENSGWVFAWAVPDNMCSPDDALGNMACGYNNICSLGNNKRPKCECPERFVLKDPSNEYGDCLPDFEMQTCRPENQTANSDVNLYEFITLEKTNWPFGDYESYANYDEERCKASCLSDCLCAAVIFGTNRDLKCWKKKFPLSHGERSPRGDSDTFIKVRNRSIADVPVTGNRAKKLDWLIIACSVLLGTSAFVIFDLLALYRKTKKSKNMMKNQARDIGRTTATTTANELNLRVFTYGELAEATRDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQMLEGVIQVFDPPNPSPYSTFTWSDE

HMMPanther: PTHR24420
1-822 FAMILY NOT NAMED,FAMILY NOT NAMED

MGSLSCSIIHLVLILQLQTFFVFSQNIRNGSVPVGESLTASESQQISSSWRSPSGDFAFGFRKIQPNDGFTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENPTDTLLPNQNIEVGRNLSSRRTETSFKKGRFSLRLEDDGNLQLHSLNAETASESDIYSQYYESNTNDPNNPGIQLVFNQSGEIYVLQRNNSRFVVKDRDPDFSIAXAVLHFDGVFAEYYHPKGGQENSGWVFAWAVPDNMCSPDDALGNMACGYNNICSLGNNKRPKCECPERFVLKDPSNEYGDCLPDFEMQTCRPENQTANSDVNLYEFITLEKTNWPFGDYESYANYDEERCKASCLSDCLCAAVIFGTNRDLKCWKKKFPLSHGERSPRGDSDTFIKVRNRSIADVPVTGNRAKKLDWLIIACSVLLGTSAFVIFDLLALYRKTKKSKNMMKNQARDIGRTTATTTANELNLRVFTYGELAEATRDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQMLEGVIQVFDPPNPSPYSTFTWSDE

Seg: seg
37-54 seg

SLTASESQQISSSWRSPS

ProfileScan: PS50927
IPR001480
37-157 BULB_LECTIN
Bulb-type lectin domain

SLTASESQQISSSWRSPSGDFAFGFRKIQPNDGFTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLW

HMMSmart: SM00108
IPR001480
37-163 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SLTASESQQISSSWRSPSGDFAFGFRKIQPNDGFTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENP

superfamily: SSF51110
IPR001480
66-206 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

PNDGFTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENPTDTLLPNQNIEVGRNLSSRRTETSFKKGRFSLRLEDDGNLQLH

Gene3D: G3DSA:2.90.10.10
IPR001480
70-206 no description
Bulb-type lectin domain

FTLSIWFDKISDKTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENPTDTLLPNQNIEVGRNLSSRRTETSFKKGRFSLRLEDDGNLQLH

HMMPfam: PF01453
IPR001480
82-186 B_lectin
Bulb-type lectin domain

KTIVWHAQAVNTTTGLVPNGSKVTLTADGGLVIADPRGQELWRALSGGSVSRGRFTDDGNFVLFRDGSEDSDEVLWSSFENPTDTLLPNQNIEVGRNLSSRRTET

superfamily: SSF56112
IPR011009
505-822 Protein kinase-like (PK-like)
Protein kinase-like domain

GRTTATTTANELNLRVFTYGELAEATRDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQMLEGVIQVFDPPNPSPYSTFTWSDE

Seg: seg
507-513 seg

TTATTTA

Gene3D: G3DSA:3.30.200.20
514-596 no description

NELNLRVFTYGELAEATRDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIG

ProfileScan: PS50011
IPR000719
531-803 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQMLEGVI

HMMSmart: SM00219
IPR020635
531-799 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQML

HMMSmart: SM00220
IPR002290
531-806 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RDFTEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVTQMLEGVIQVF

HMMPfam: PF00069
IPR017442
534-796 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TEELGRGAFGIVYKGYLEVAGGSEVTVAVKKLDRLDLDNEKEFKNEVKVIGQIHHKNLVRLIGFCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVT

PatternScan: PS00107
IPR017441
537-564 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGAFGIVYKGYLEVAGGSEVTVAVKK

Gene3D: G3DSA:1.10.510.10
597-796 no description

FCNEGQSQMIVYEFLPQGTLANFLFRRPRPSWEDRKNIAVAIARGILYLHEECSEQIIHCDIKPQNILLDEYYTPRISDFGLAKLLLMNQTYTLTNIRGTKGYVAPEWFRNSPITSKVDVYSYGVMLLEIVCCKKAVDLEDNVILINWAYDCFRQGRLEDLTEDDSEAMNDMETVERYVKIAIWCIQEEHGMRPNMRNVT

PatternScan: PS00108
IPR008271
653-665 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPQNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox