PRGDB00065844 (At.319)

From PRG Wiki
Jump to: navigation, search
At.319
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 240255700 (NM_116257)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RLK4 (RECEPTOR-LIKE PROTEIN KINASE 4); protein kinase

DNA Sequence

ATCTTGCAAAAATTCTCTCCACATTTCAAACGTCTAATAGTTAAAGAGAGCTTTTGTTTTTTCTTTCCCATGTCTATCAGTATCACCACCGAGAAAATATCATCAACACCACCAACCAAACATTAACCCACCCGAGAGTACCCAATGCCATGTACTACTTAtcttcctcttcttcttctcctcttccttcttcCACCACCATCTGTACAAAGCAAAGTTATCATCAAAGGAAACCAAACCATTCTGAGTTTCAAAGCTATTTTCCGGCTTGGTTTCTTCAGCACCACCAATGGTTCCTCCAATTGGTACTTGGGTATCTCTTACGCTTCTATGCCAACTCCCACCCACGTTTGGGTCGCCAATCGAATCCGACCCGTTTCGGATCCTGACTCTTCCACTCTCGAGCTCACCTCCACCGGATACCTAATCGTCAGTAACCTCCGTGACGGCGTCGTTTGGCAGACGGATAACAAACAACCCGGAACCGATTTCCGGTTCTCTGAAACCGGGAATCTGATTTTGATCAACGACGACGGTTCTCCGGTTTGGCAGAGCTTTGACAATCCGACTGACACGTGGCTTCCGGGGATGAATGTCACCGGTCTAACAGCTATGACTTCGTGGCGGAGTCTCTTCGATCCTTCGCCGGGGTTTTACTCTCTGAGACTGAGTCCAAGCTTCAACGAGTTCCAGCTTGTTTACAAAGGAACCACACCGTATTGGTCCACCGGAAATTGGACCGGAGAAGCCTTCGTCGGCGTTCCGGAAATGACCATTCCTTACATCTACAGGTTCCATTTCGTTAACCCTTACACTCCCACGGCGTCGTTTTGGTACATCGTCCCACCGTTGGACTCCGTTTCCGAGCCACGGCTGACGCGGTTCATGGTCGGCGCCAACGGCCAGCTGAAGCAGTACACTTGGGATCCACAGACGCAGAGCTGGAACATGTTCTGGTTGCAGCCGGAGGATCCTTGCCGCGTTTACAATCTCTGTGGTCAATTAGGGTTTTGTAGCAGCGAATTGCTCAAGCCCTGTGCTTGCATCCGCGGTTTCCGGCCTAGGAACGACGCCGCGTGGAGATCTGATGATTACAGCGACGGATGCCGCCGTGAAAACGGTGATTCCGGCGAAAAGAGTGATACTTTTGAAGCCGTTGGTGATCTACGCTACGATGGTGATGTGAAGATGTCACGGTTGCAGGTAAGCAAGAGCTCTTGCGCCAAAACTTGCTTAGGAAACTCTTCTTGTGTTGGTTTTTATCATAAGGAGAAGTCTAATCTCTGCAAAATTTTACTCGAGTCGCCGAATAATCTGAAGAATTCGAGCTCGTGGACTGGAGTTAGTGAAGATGTATTGTATATCAGAGAACCAAAGAAAGGGAATTCAAAGGGAAACATCTCTAAGTCTATAATTATATTGTGCAGCGTTGTTGGGTCAATCTCAGTTCTTGGGTTTACATTGTTAGTGCCATTGATTCTGTTGAAGAGGAGTCGAAAGAGGAAGAAGACTAGGAAACAAGACGAAGATGGGTTTGCTGTGTTGAATCTTAAGGTATTTTCTTTCAAGGAGCTTCAATCAGCTACCAATGGGTTCTCGGATAAGGTCGGACACGGCGGTTTTGGGGCGGTGTTTAAGGGAACATTACCGGGTTCTTCTACATTCGTGGCTGTGAAACGCTTAGAAAGACCTGGAAGCGGGGAGAGTGAGTTCCGGGCAGAGGTATGCACCATTGGGAACATTCAACATGTCAATCTCGTTAGGCTTAGAGGTTTCTGTTCAGAGAATCTTCATAGGCTTCTTGTCTATGATTACATGCCACAAGGATCCTTGAGTTCCTATCTGTCTAGAACAAGCCCCAAATTGCTAAGCTGGGAGACCCGTTTCAGGATCGCGTTAGGTACTGCCAAAGGGATCGCGTACTTGCATGAAGGATGCAGGGACTGTATTATACACTGTGATATCAAACCGGAGAACATTCTTTTGGACAGTGATTACAACGCCAAAGTGTCTGATTTTGGCTTGGCTAAGCTCCTTGGACGTGACTTCAGCAGAGTTCTAGCCACGATGAGAGGGACATGGGGCTACGTGGCTCCCGAATGGATATCTGGTTTGCCCATCACGACAAAAGCTGATGTGTATAGCTTTGGAATGACATTGCTCGAGCTGATCGGTGGTAGAAGAAATGTCATTGTTAATAGCGATACACTGGGAGAGAAAGAGACAGAACCAGAGAAATGGTTCTTTCCGCCATGGGCAGCGCGTGAGATCATACAAGGCAATGTGGACTCTGTGGTTGACTCTAGACTCAACGGAGAATATAACACTGAAGAGGTGACGAGGATGGCAACGGTGGCGATATGGTGCATACAAGACAATGAAGAGATAAGGCCAGCAATGGGAACGGTAGTGAAGATGCTTGAAGGAGTTGTGGAGGTGACGGTTCCTCCACCGCCTAAATTAATACAAGCTCTTGTCTCCGGCGATTCATACCGAGGAGTGAGCGGCACAAGCTGTAGTGAAGGCCATGGCTGTTCGGATCTCAATACAGGTTTGTCTAGCCCTGGCTCACGGTCGTCTTTTGGTAGACCTTCTCCTTGATCAATTTTGTAAGGTGATTTGGTCAAAACCAGCCTTAAATGTTTTAAGTGTTGCTCTCTAAGAGGGTTTAATTAGTTTAAACTGTATTTGTTGGTTGTATGATATTTGACTTAATCGACATTAACAGTTAAAACCATGGATTATGTCTTTCTTCTTAGTTTGAAAGTTCTTGTCACTTTGATAATCTTCT


Protein sequences

Name Description Sequence
At.319 translated coding region predicted by ESTScan from UniGene At.319

MPCTTYLPLLLLLFLLPPPSVQSKVIIKGNQTILSFKAIFRLGFFSTTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSLFDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNWTGEAFVGVPEMTIPYIYRFHFVNPYTPTASFWYIVPPLDSVSEPRLTRFMVGANGQLKQYTWDPQTQSWNMFWLQPEDPCRVYNLCGQLGFCSSELLKPCACIRGFRPRNDAAWRSDDYSDGCRRENGDSGEKSDTFEAVGDLRYDGDVKMSRLQVSKSSCAKTCLGNSSCVGFYHKEKSNLCKILLESPNNLKNSSSWTGVSEDVLYIREPKKGNSKGNISKSIIILCSVVGSISVLGFTLLVPLILLKRSRKRKKTRKQDEDGFAVLNLKVFSFKELQSATNGFSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMGTVVKMLEGVVEVTVPPPPKLIQALVSGDSYRGVSGTSCSEGHGCSDLNTGLSSPGSRSSFGRPSP

Domains

Domain Start-End Description Sequence

Seg: seg
7-19 seg

LPLLLLLFLLPPP

ProfileScan: PS50927
IPR001480
18-139 BULB_LECTIN
Bulb-type lectin domain

PPSVQSKVIIKGNQTILSFKAIFRLGFFSTTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFD

HMMSmart: SM00108
IPR001480
24-141 Bulb-type mannose-specific lectin
Bulb-type lectin domain

KVIIKGNQTILSFKAIFRLGFFSTTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNP

HMMPanther: PTHR11795:SF54
25-408 RLK4 (RECEPTOR-LIKE PROTEIN KINASE 4); SUGAR BINDING

VIIKGNQTILSFKAIFRLGFFSTTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSLFDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNWTGEAFVGVPEMTIPYIYRFHFVNPYTPTASFWYIVPPLDSVSEPRLTRFMVGANGQLKQYTWDPQTQSWNMFWLQPEDPCRVYNLCGQLGFCSSELLKPCACIRGFRPRNDAAWRSDDYSDGCRRENGDSGEKSDTFEAVGDLRYDGDVKMSRLQVSKSSCAKTCLGNSSCVGFYHKEKSNLCKILLESPNNLKNSSSWTGVSEDVLYIR

HMMPanther: PTHR11795
25-408 FAMILY NOT NAMED,UNCHARACTERIZED

VIIKGNQTILSFKAIFRLGFFSTTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSLFDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNWTGEAFVGVPEMTIPYIYRFHFVNPYTPTASFWYIVPPLDSVSEPRLTRFMVGANGQLKQYTWDPQTQSWNMFWLQPEDPCRVYNLCGQLGFCSSELLKPCACIRGFRPRNDAAWRSDDYSDGCRRENGDSGEKSDTFEAVGDLRYDGDVKMSRLQVSKSSCAKTCLGNSSCVGFYHKEKSNLCKILLESPNNLKNSSSWTGVSEDVLYIR

superfamily: SSF51110
IPR001480
53-199 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSLFDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNWT

Gene3D: G3DSA:2.90.10.10
IPR001480
54-198 no description
Bulb-type lectin domain

WYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSLFDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNW

HMMPfam: PF01453
IPR001480
67-167 B_lectin
Bulb-type lectin domain

THVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVVWQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSLFDPS

HMMPfam: PF00954
IPR000858
193-308 S_locus_glycop
S-locus glycoprotein

WSTGNWTGEAFVGVPEMTIPYIYRFHFVNPYTPTASFWYIVPPLDSVSEPRLTRFMVGANGQLKQYTWDPQTQSWNMFWLQPEDPCRVYNLCGQLGFCSSELLKPCACIRGFRPRN

Gene3D: G3DSA:2.60.120.200
IPR013320
407-500 no description
Concanavalin A-like lectin/glucanase, subgroup

IREPKKGNSKGNISKSIIILCSVVGSISVLGFTLLVPLILLKRSRKRKKTRKQDEDGFAVLNLKVFSFKELQSATNGFSDKVGHGGFGAVFKGT

Seg: seg
411-425 seg

KKGNSKGNISKSIII

Seg: seg
448-458 seg

KRSRKRKKTRK

superfamily: SSF56112
IPR011009
470-790 Protein kinase-like (PK-like)
Protein kinase-like domain

KVFSFKELQSATNGFSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMGTVVKMLEGVVEVTVPPPPKLIQALVSGDSYRGVSGTS

ProfileScan: PS50011
IPR000719
482-763 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NGFSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMGTVVKMLEGVV

HMMSmart: SM00220
IPR002290
482-739 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NGFSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAI

HMMSmart: SM00219
IPR020635
484-759 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMGTVVKML

HMMPfam: PF00069
IPR017442
486-682 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNV

PatternScan: PS00107
IPR017441
488-511 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGHGGFGAVFKGTLPGSSTFVAVK

Gene3D: G3DSA:3.30.200.20
501-559 no description

LPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMP

Gene3D: G3DSA:1.10.510.10
561-761 no description

GSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMGTVVKMLEG

PatternScan: PS00108
IPR008271
602-614 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPENILL

Seg: seg
762-771 seg

VVEVTVPPPP

Seg: seg
805-818 seg

SSPGSRSSFGRPSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox